MZ@ !L!This program cannot be run in DOS mode. $PEL DkV 8 @tr@`0 PD.textdx 0`.data@`.rdata\)0@`@.bss<@.idata @0.CRT40@0.tls@@0.rsrcP@0.rossymipBUju uF U} t ɸ ujj{F L$ʋtADADSD$ \$(AtB);JrB [1WVSÈT$x 1ҊD$8B! ut>Z[^_SËf/tf-t 1f9\ Cu A[P4B`4Bp4BáP4Bá4BA1ҡA|$t|4B9Pt'9t#PË4B9Pt 9t@桠4B4B֋T$tf"tffUVuSto~u 1ۃ~t?;^ }1Ft#PjFJ(jjPFCvuYFt hjPjjVjPje[^]UWVSExxxu 1e[^_]É{t{tC Es$EU;SsʋMPu TCZYtEt;CwS<U1WVS`}]u ,BBEE!EEUEU9Utbj&j )VSWjj VS0fD}E~XguN;u6ES)PutU fe[^_]Ã}u?j&j VSVj+}j VS0fD}EXÉЃ ؉S놋UET&UU+EfTEE럋uiUVSÉH ECC4j jxPs3j hPs؍e[^]UWVS(Ef8MZt 1e[^_]ËURgËEFvPSDr ^E(`MԋE+A4EUЋMЋRU考xEЋBEtUЋ:G9E^$yى%@҉% ҃ЃANNKEPRQvpfE({MЃy9'41ۋQB9sTY fu EC‹}8jWfG EPeE@UЋB PrpMЉA^XA M @UЉB u]_ދt4|MDu]_%Pu~etnŃIh@vve@uG$G G(uEcjjuEЅuu1[CE@UjP[ZYUVuS] SVCSC e[F^]UE AVSXuD1 w`A1ҋE ‰Af>t7Kt1VCtFXShAjYhAhAh Ajc뙍e[^]UVS1ۋ@Af8t/PCP4@AVpCtCDAe[^]øUv Bø)PcUVSj 0 CXZtjPCZYt%j6 CZYte[^]f;u 1҉UWVSU Ef8tIEfe[^_]jh(APpC Eu[EIEtHU :_jSCY^CjSC_ZC Eft]uuj1h(AupC uffE*fMEEU  ߉E Ɓ fSCYЍBfv E 58BjSC_Zt'C ؋E f{1SCYЍBfwBUWV1SE8t0t1f"fC1փf/tjPCZYtfCEe[G^_]USjSCYZu0҅u]Sh0A C[Z1҅UWVSjPCYZt1f;t1t-te[^_]1f;"1jPCYZtUVSjPCYZ1҅t+jPCYZt k fDfՍe[^]úUVSf8u e[^]ÍEP'`fEfEfEfEjPC[Zt4jPCZfYtEk DfEf;Bt1jCPCZYtjCPCZfYtEk DfEf;BujCPCZYtjCPCZfYtEk DfEf;BtD=Btbf}\f}<Qf}<Ff}:EP_jCPCjCPCZYtPC[fPt+PCYfAxf} mfEmE fEUVSEf8ue[^]ÍuV^^lBfEfEfE]U1҅t u1룍UEfcMȉ1f]Cf wUtk f9 ArDfwwEP]']UppaUOOuI=,,U UcfOwlfEdȉ1USf8"t؋]ÉfBHfvj"R0CYZtfUWV1S1ہE fUfuPCY_WCZ9s1f<_"Cj S CY_<11DžDžVCZ9^f"f f\xj"W0CPuCj"W0Cj\W0C j.W0CY[tCVCYZ9w'tCWC^Z9wfBPu CY[e[^_]SuCj\S0Ct f@SʋM fj S0CPuCuSCj S0C j\S0Cj/S0Ct!CVCYZ9Ct!CWC^Z9uu CMDQPuCUfDBRu C] u Cff X 5Bvf tFBpQSVP=t a a@ PBPRhAWCjpSVRh|AWCe[^_]UWVS}]  uXdȉ1lBtBt^\ CVPRCPRCPhAuC e[^_]É봃\ CVPRCPRCK\ C[QRSRVPhΠAUWVSSCYt^;WCZtf_t)e[^_]f_tUWVShAPCZYuVWCY[e[^_]hAVC[Ztj.V0CZYt)SVW(C f_VCXUuT1tUuhT1t ЃU@WVSDE }f ATWVCVC Ff\XuSCSCCSkuof>ej;V CXZ)PVw(C f ASu CY[e[^_]ÉAËE1SPhAj^h4Ah(Ah AjqR tPWVCVC Ff\XuSCSCC Au ZɉPhAAjl=V1CXZS$_ tPhAAhh4Ah(Ah AjQ1Uv BøR)P9RUVu S]9ue[^]C PRSCCUSQURj(PUu]ÍEPhNAjU]t;jjjSjuEETtQuQ1uQ1UWVSjuQt e[^_]hQt1Ef8uuf>\uEfx:uƃj\V C[_t Ã+] uCYSuW(CjWfDŽ]P t uaP=tgUWVS`uSChrASCPSPSCfDŽEt/hAVC[Zu'PWmPuWkPukPe[^_]hAVCZYtǍPSCVSCuhS&PS(PuSX|UWVS hxAPhAPsOhASfOF>jPhWOue[^_]jjEPPքjROjhjjjh@uO@PCYED8E>\$sEfCfCfCEfC uVCEf{fC PC VCEjPjjuSh Nu'WNNEP10NEPUVSVhpNupNVhNe[^]UWVS\hAPChAu C}DžuCY9f?\t%jWP CuCH9udVCZu f:tUPV`Mtgh8AVCPu Ch8Au CS9MMVu Ch8Au Ch8AVCuu C[^e[^_]USjLÍEPjEPSMf}u}uE uEftftftE]f}CuAUVSj]Lt EPjSVLf;u{ue[^] AthAj@hYAhѡAh Aj9KUS]SKj@hAhASjhRLjSfDŽA AP ]ɸAUShSjhLf\ CjhlBh! hKhSjhKfBjhBh# hKhSjhKfBhSjhKfBhSjhmKSC[],BUW}Vu S]tf{:tVWKe[^_]ÍB1f wJBfvBfvWVQC 뿍BJfۍJUVuS] SCZtjVhSJe[^]f{:uhVSK U}W} VuSu3j\V0CY[t;)@PVW(CfD e[^_]V%ZtVWCY[hWVU҉WVS MUEt+}tf;EPCYuZf9tEEEe[^_]UWVS< AhAIhUAPH AU1׹E<REEE EȋEE̋EEЋEE AS8Ht{Ee[^_]ËE {PhAh hAhAh AjG> At6h0AhhAhAh AjG1 Au SG1heAhhAhAh AjNGPhAhhAhAh Aj(GPhĢAh'hAhAh AjFUW1V1S]tDBf w|F u1e[^_]RCZ`~f|ΉUWVSuU؋FPtPs]SA9EPSGt!v(]SWSu_e[^_]Í]SA PGt뻍]SAU}jY EE EFURPlGUVSj]u }FURPSGttfEft&EffEPfEtfPtfe[^]Uj&FURPFEUj FURPFEUjEURPFfUEfUE fUE S]j ESPF]USjEÍEPSFEEPSwF]USjlEÍEPSPFEEPSHF]UjAEP;FUVSAuu=AuVFVP5AhAdP=At܋AAt΍Cpp C0sPh-A0PCxMEyu h\A PXC1ɺEERthAOYUVSPhAO3VhAOss ḥAO u uhAOjjMhAhA\Cj*EUWVxS΃ÍM@Et 1ɺEEte[^_]ËM AVWJYXˋMڸ;AVW5XZUEtM4U x]US]t)U 4M[ A)ASCBSNN]XUVS]ue[^]Ã{3tjhhUAhnA\ChhUAS| US]t<t!hhAS6 ]ËCthhAshhhAshhAsUVuSt3thhAP hhAV e[^]UStT;4BtL;4BtD@thhAPl SPhhASM 4B] At54BShɤAhhAhAh AjA US];4B}4BRA[]U塠4B@;4Bt/hhAPhhA54BË`4BUB`4BtjFh3ARx P4Bp4BU=P4Bu]UVuSFTP{KÅXt8ACA5APCAuM AXe[^]UWVS1Atf8XtPCZCe[^_]jhOA)Wc t WVPK VEAUWVSALELA AaljEtVf?t>j=_S CXZtf^jW@SC|F WCA@AthhAP A6AUWVS]h}hASKjƍEPSVW? uhhAV;1 e[^_]uj VCU Ӆt)Xjj)PW>tCPu jVj5B>h hAVUEVu S4B;A|4BjPC[Ztf>u4BAe[^]Ã=4BuoV4BChhADPC4BVpC4BhhAj $4BX@4Bw4B@pVCZY[p=4Bt'|,LA4B9t^9tZA&f&A4B9Bt+9t'A@A@PVC[^4BA͡4BA뚃=4BUS]t,A;4Bt$;4Bt3A{SjDY[]Ë@;4BAtA͋AUhhAj 4BhhAj 4Bi4B4BBBP@AUWVShhvAhhhvAhtYtUhuVEhu SESV;hhvAV$hhvAS e[^_]1UWVS QEn:jEEPVuu;uv=AuXhhѡAAuAPu[^뽃jPCZYtf;u1둡lBUt\ Ct!PPht1 \ CPPhuPPhvUS]SCM ‰M A[]UjuXZUSE EEPjURhujh/0u(h Sh>5Bg2S/Y]uu/USsE EEPjURhujh/u(h Sh>5B1S[]uu/UWVSj}Vhu |.ue[^_]ÍSVS`C u!tjWSpC t-P1^AW-.USmh Su5B1jS]XZUSf+t\vf/tBv/f^t\f|tZf&tJf*tf%t)h1Y*f-u)   ]! 1 UWVSUEEPEPUY[tQEtQPW C[ZtCEfBHfvEPEUPUZYtME1e[^_]ËEUEUAU EhP@SZUAU EhdA8YU AhP@#ZU&AU EhfAYUjmAAXUjn*AXUjjAXUjiAXUjhAXUjgAXUVSj]9+ڃƉ%9t=} tDEށPV+EUPEjPSVm,SVn,e[^]h:RZPUjuYXUVSh.AhRAhpshjVDžY5S,uhA[e[^]VCY\F))ƒvjh`ASpC uShXZUSh Su5B-jS]XZUSEt Ht#A]A=Auރ=AjEPh5B2-hPPC؍E$P C t4thpAhf9]Yt'1f9]1f ‰AHfuA1>=A" AUuojYAhhShAXZ]1ÉPhȧAjzhAhߧAh Aj&h-X AUS]u#jhAS$C t8S Y1]ÉPhAjkhAhߧAh Aj[&h AUS]u)jhAS$C t>ShA'XZ]1ÉPhAj\hAhߧAh Aj%hT[USjhAu$C t+p4BAtCPeXu]1hhYUSjhAu$C t=P4Bu؋]h1Y`4B1ۃP`CZUS]jhAS$C tSPh&f;uPSCj%h3AD Pt@`4B҉Pt78h1[]SjZYtAڣp4BS`4BPC1[P4BXAUWVSTju} ]1Y AV$jhjjjhV%@ AjjEP% AE,E%WZ}C AhW^$ AWS$jhjjjh@WS$ƃjhh@j}#rjEPh@S$EftjURPSV$E;EjhA1hjS"Vf#[#^1Ae[^_]h.AjJhTAh=Ah Ajh"Djhjjjh@Vg#t=uVg$]SVe$SjjWb$uWAW"AJVh?_1YA[WhUAjrhTAh=Ah Aj!EuhiA AVhcAhpAjwhTAh=Ah Aj!hShA#h8ASCj\V0CPSChASC jjjjSVs#uADSVCXZ^WSChWhA+#h8AWCj\S0CPWC ,hAhhTAh=Ah Aj H.PhAhhTAh=Ah Ajl PhAhhTAh=Ah Aj< VWECY[tA AuHhW !jhjjjh@W!jEPjV! hAhhTAh=Ah Aj] jgVS H jmujSC u%E|jZ>)@EDž AjjEPVY!hjSOV AW(DžnhAhhTAh=Ah AjSa AujEPjSVB AhAhhTAh=Ah Aj.h#AhhTAh=Ah Aj jjjjPW; t WWA17P!UEfEEUVtAShSh2Auue[^]f$t 5PC[fHv9fQ'fTfV"f_nfCvfEs>fAtkvj|:f$;f+u1;P4B}j+CYfFtLfGuj>fNtWfPtofLuj<fSoj j&j(jj)jj jvPhMPSh/S j=oPhAXZBt'5B5BhlA =BthVA=Buh@Aj [j$UV1S1ۋ At.$At CtPhAVXZP1Xۅue[^]j x^U1]UɉWVS1ۃuMUVQYXWCZ9} j C2YujWtCVue[^_]UWVS] jWhѡACPEEL} E1jƍEPVjVEjPuuVuuuuj5< CjehѡAu5}tf tfuVe[^_]UVS Eu8j ]S&hASxCjPCZYtPXh Sh5BjSV$C ue[^]jPV$C u1jPV$C tUVS Eu8j ]S[hASxCjPCZYtPO[h Sh5BjSV$C u e[^]jPV$C1 UWVSP  E EPSh DžDž[SSCj*S ChASC^_ EPShP0PSDž@03swx e[^_]SzY1SCZfE\uhASC_X h8ASCY^hإASC_ZSC^fE\SC[fE*hyYuDžFt0 uuu @{0PRn10ux0tj0j`0 `V0VL0LB0J=\Pu荝CSh2BC AuFuhPjZ胰PhAhhAhũAh AjShHhIj uAqd捅PhJ^_Yu/xGP]ZhAPEY[0tȍhP뵋L1ۋPCљ0Cujhjjjh@PWDž(Dž,1ۉ 1$(d,;$}ajEPh0PW?(,hBRPRPhܩA"~8jEP)P0PWhBhAWXZk; YSy_Dž*j\ 0C [^txjSh j\S0CZYtYEhAuCPP[ƃXu!PVuV]hASCZYthASCZYtSuCh8AuCWuC myUSj/u CYÅXCPCZfFt,vfRt0fStS]fAuCPje1Y[FB88hSPfXZtSj.[X׍CPCYu1]P1Z4B;4BtsDXUVuS1ۅt*VCuu DPHt VPCXZe[^]UWVS}} G̍_̋MwЋUEWЋFBE TPSXZAtbE +EACCAPuMU AoYÍe[^_]uuu u1uW GЈAV25AU AWVShh(Ah2hPh$A =t}VlC_jVu u蟻Efx:hh(AV1 e[^_]ËE親PhAhh Ah(Ah AjIh@AVCY[xhh(APVAhh Ah(Ah Aj vhh(AWjhh(AVZ1/tC1ۋhWPCY_tgt?f8"1"ÍV븋1f8"Ã뢋jPC_Zu f8/u9u h=hA)CP ;SVPDfW}f>/}j*W CY[Wj\W0C^Zh)hACP Ɖ@PWV fDPW @e;VCRChhADPDžt=VPCRPCESPEPjhhAS(Pwt Xcth hAV_ hXhAW? 5j?W CY[WEPEP uhShAWu1e[^_]1PEPEP WEPEPc 2hJ딋E UE1UWVS]jhAS$C twjE1PSA EEEE;}hA4hCYZu}t>hA4hCYZt37BBPRRhAe1[^_]E}t f8/t GEj@PCYZt}u0E@PCZfSt(fFuUB0E뫋@EpE돃}tB}u!}t,}<@AuVhA7<@AthAN<@Au4O@AhApAVh<胮P:@AhAVh[PfU+pA6SSXUWVShA]njhASE$C tRj1EPS EEElj;uf8/t,}RUDBUGhib1[e[^_]h.APhCZYuMh4A3hCZYu EFh:A3hCZYu Eދ@PSW}^tow}At4}tYu]+uphdAP-Y2h@Autu܋]uSVЅtSVh1hTAurt]ujSVЅtSVhVSh 1 PbWyUWVSjchrAhE3 EEJWCYE]];]r!ejlhrAEPVt@ԋUWVPCX]Zuh WC uEfFe[^_]1UWVS uE}fjPCZYtjhASpC DžtVSCVPCSCW9hPASC^_SCYl1PPSfDžfDž) dWCZ9fu"dFjhASpC Džt fDŽ}7SC^=h@APCh0APCDžl|PP'Džp1DžhhAVCZY|PSuShA@hWp hPASC Aufi Aj pP CY[t1ۃDžxVCZ9^f"f hASCY^wSCPdSu  hjSj jShW l~faUS]SjYt ‹]hAShCYZtehAShCYZtlhAShCYZtdhAShCYZt\hƫAShCYZtjhܫAShCYZubj hBj:hBhBi]Syj hBP@CB 5q)hAShC[Z1҅j hB5AUSPZtjjP" ]1UWVS EPhjhAhEEEwuEPhjWu_ut]SjjjjuOtuu~EjDh0APSPjjju"u u uX}t!_uuu1e[^_]uuuujNh0AV蜴,VWhJA }tjXh0AVn UjhAUjhAUhFXEP臫EYftftftEfuAfCtE uU$ WVSE]u SI}tu}EU)ЍxEރuÍV1PC1҃ ;qFf t EC9|ڡA1@9A|GAEPdSuV1 e[^_]øjEP)PQPHu׉1AKj)֍EPVQP|1UEUM UxujRQ`1 jRQjUWVS1ہDž<Dž@8;86=A)JP@@ +PFPSE+hإAPCPSƃt)hARhCZYuPVV1whAQhCY[ttE썕F+>PRSPE+PCh8ASCuSC$`VUjEPu Eu:US|h Su 5B*SuY[]UVS]ЭAԭAjhASEU$C t(Af;t/SxCf{:^hj`Y1[e[^]ÍDPhvDuVfEחZtkjjjjEPjPLSVtefLEulPh]^XERPhF Ajf讹ALuhAP袬3SPh US]jhAS$C t%hh0AS说 t#1Ahj51Y[]h1ZAUS]hAAS8CZYthj1ZY]誹1f;thحA臹h6A}YXf tWf/tJPCZfWtIfRtJfCuQhh hݹh!ӹf{tj hh譹YPZBh菹1UWVSj]jhAS$C t3f;tEjEPS1 Dž;]}uf8/t;[hj1ZYe[^_]虷SA;PC_v@PCYfPtCDžDžDž;E`f8/jhjjjhA4 hWS? WhA DžH뼍X@PCZfPaSh]譭_X-)]jjShPjh7u4hAGu!A jEPhWSt)Et"jURPW=ADSYVٞ1[US]f;u1]jhAS$C tShju1[ZUWVSd]jhAS$C tMjEPS1A ;]}EhA4hCYZf8/t!thjXZe1[^_]ÉC붃tq-h\ԲXAh*]j(S  AuJf}tp]SC^f|Ew]SC[fDEhͮPhAd 땉zPhAhh_AhAh Aj*뉍E>W3Y]SS]S S軴WUxWVSaDž?Dž?Dž?Dž?Dž?Dž?EjPCY[Ef"tf/EEK}f?PCZfDtefIhAShCY^Dž?tDž?eE\?WE|P??C?f{u)EjPC^ZtEE|??r[|B?hȮAShCZYuDž?hЮAShCY^uvEjPC^ZtEE|jÍEPS ?Ef8tSjk?Y[e[^_]Ã?tރ?tՃ:hAShC^ZuhAShCZYu@hAShCY^u hAShC^Zu πhAShCZYhAShCY^t}h0AShC^ZtvhHAShCZYtohZAShCY^thhhAShC^ZhlAShCZYSh]_$@hhvAh0 &j?h?hA= EAf86EADž|?u?SCS!pVSALSVC^X@uf@???|?PREE?u> < CBh<hvA?U1҃ UFhA?CY[hhvAP?SPhA?111ۋEf"t,jRCYZu'׋ET|?fʅuj.V0CXZhAShCZYu?h̯APC A|?t"hASC|?SCjDjEPl ?u??EEDfE̋?EEPEP??WjjjPR@?uCh¯AShCY[ AuYu1PCXZEsÉsSPhAhhhAhvAh Aj EsÍ?sSPhAhhhAhvAh Aj h?uaua!jP\EPuXEAVhAP胟Y[ hjf1i AUS]urjhAS$C =AAhxAShCZYt]f;/1ۃ AS܉zrPhLAj*hrAh_Ah AjaAt1ҡAB u1]hj{1Y[ASBf PR!ZUWVS]jhAS$C t!AjPC^_thjZ1Ye[^_]f;SCfXx BH9~ h-Tj S C^ÅXtMjPCZYtf;t0SCfXx BH9~#hlgWYj S CXZtjPCZYtf;uWj AяWV A軏S讪1 UWVSLuPV蝇Pu 莇CPf$$jjjjhVfHEPEPEPWyVu zZ)E?Eu hz^XPPCY[jjjjjh@u jhh@j&u EPEPEPVjEPh@SWBU{jEPRSVYE;Eu j ZthAéhhAS;VW1AVh?whu E u9u Eu~u h?^Xjȸ1[jjjjjhu ÍEPEPEPSE9EwtWDS>1IE;EvS,ou hu h8hejBWEX1Ye[^_]WhejVWjmjhjS?VWUWVSdPu u CM ^PDA~f9\tJf1j5[u7t.hAVCZYu P6ue[^_]hAVCY[tuuSCVSCSEuNS3}ZtuOu SCPSCuuPS t8GNS|^?EuShcEY[2M9UWVShhAuCPuuCM PDA~f9\tJfDžu WC[^tfSt31fAtfPu9 3P虋]G ~M(uV3CZtdj*3 CY_P3}hjthbjhjfz:uhPR裂 3CZ3PY_j*3 C_ZrWCYfE\th8AWCXZPSCURWSV7)tBVShH[^Yj?3 C_Z3SSw Sh`Phfx:PPCj?3 CY[STwZu3Sgw_hj' ShdYh责~}EPWRVUuhhjShUWVS ]jhASE$C tSjEPSA }P!11DžTM9Pf8/tDhj1Y[e[^_]PCZvP@PC_EfvFC$lAT@郍TT׃T΃TŃT 뼃=AtTF9}TtPPxa1Dž\Džd9}+Pf:/t\d\@j\\ CY[0j\\ C`XZj\` C^_t`j\` CY[u\C`C)S\S(Cj\d Cj\d ChXZj\h C^_thj\h CY[udChC)SdW(CWCVC9PIDž`DžhDžpj\\ C_Zj*h C[^2Džl ABxP\-t@DžXhASCZYtTP1_VCPWV$CDžpSPCd[Džp^hj\d CZYt d谍P舄b\d`hj?h C^Džl_`aƍaË\aVSPhAhh|AhϰAh Aj$ Afh\aƍOaËdBaVSPhAhh|AhϰAh Aj~$T(聚hASCY[uxPt"xuרuD AuShf*tdf?t|ff;~ltT y뤍Z`Ph)Ahh|AhϰAh Ajytf9xf_fQmfpCt{WSҍPVC ATPTPPTwPhZXZ`PSWSCPVCRVC d _Ph@AhKh|AhϰAh AjK=PPhVA8 *XXt Xhjh\^_US ]jhAS$C t/f;uThA]SCSh2AgZY]hjhjhjz1Sh2A"US]jhAS$C tf;u"pu(hA&hj(1ZY &]hA1[ AUS]u,jhAS$C tJf;u;觚u]1Ée]Ph.Aj(hAh@Ah AjS討Xhj[XUS]jhAS$C t>AtGt@f=Sh4A1҅uAhjX1Y]j5hYAh蹀hPh4A; t =w6h4Ah;j>hYAPSJhPh4AShrA谍jChYAS}1҃n7UWVSujhAV$C tTE1PVA肳YDž_;]hA4hC_Zu!\hj1Y[e[^_]ËhA4hC_Zu !hA4hCZYu CrE)؅~FKHDžAtDj* C^_t%ދXXRVCj? CZYuNjj*3 C^_DžjVh AEPVh3Etf A\P3肿hAWCZY\PVVu胓V`j?3 C^Dž_;,YPhAhh~AhAh Aj,YPhAhh~AhAh Aj,hAWCZYK\\PV腾\uhA萊XDžVT A\P3)@hASC^_\Pu# {'DžKԲAuAPhٲAhh~AhAh Aj肼"BSPs}z \hASCZYf;t  A.PSCSC fE\th8ASC_XPSCSSCSg A t+,WPhAh/h~AhAh AjjSyg^SgY AjP 茇yVPhAhh~AhAh Aj辺1H _u\PgS\~x1Zb AuTSSCSC fE\uZPSCSOf tO@ UPh$Ah8h~AhAh Ajչ|h8ASC^XSeYt AuH SPCXZK"UPhBAhLh~AhAh Aj`h[AhUh~AhAh Aj5  SVhtA $%=eSPCVSCP蕹jPWhWPPC[^uu 惍惽 @b@PhMj؝ -$h8APCh8ASCPCSChإAiWتEPEPjjS&ruh6AvDSjPCUX1YvRΫ1i蒪]jjShPjh蠫u6hApu葫A hƳA~vSvhAnvhAdvEPwvhAQvhAGvEPZv hA1v]hbA"vXxhfAvXqhjAvXjhnAuYc詩]jjShPjh跪uhrAP耩]jjShPjh莪uhA'W]jjShPjheuhƴA~ouXA_Z AUS]u&jhAS$C t;SQoY]ÉCPhhAj6hAhxAh Ajhj1[ZUWVS AEuejhAu$C t|=At~Ef8t}Ej PC^_uzjPCZYuhf;:tbыEBPhAj,hAhAh Aj-mhj1^_e[^_]hTDsh[fhAuEhCZUYAtYjRjp舨Ah h:.u^ShC_ZtuShC[^1uhUq0gUWVS]jhAS$C tf;uDSh苦fDžHjEPR Dž<@<;E@ЭAԭASEСbAUԉEC_vf{:t%hjܾ[^hRqY-uPfEC$jjjfEEPj@LPV fLERPhҵAURCEPEPEPEPV輦t}E؍Ejj(eWlRP:EE܋M+Mjj(VRPf:E؃(Ejj(eSRPM:ESVWPLREPh4s0.h DShR5BEPShµAj <^h DShS5BçLSRCXZ@paXe1[^_] AUS]u&jhAS$C t;SWj[]É>PhAj'hAhrAh Ajhjڼ1ZY AUVuSujPCYZt/G>PhAjEhAhߧAh Aj舢jhAS$C t hhASr te1[^]hj?XZFPw^UWVS]jhAS$C f;j1EPSŗ EEE;uf8/th}}P4Ph An }hjv1Y[qvfxPuf@fMt?vfkt%fmt1fat"Rhgom`fAtfKuEUELECPkPZZtP84Ph Am4h Am[XS FW^1Ye[^_]UWVSuEM؉UEE EEU{SCf}/_tEf} hf/Cf 9f}O"f}Tf}A$Uf uU1f-EÍXE8WCYfAfTfOfLfBfCfW fDfNfPfQfS"fX'f4,1F(UB<E fOtNfTt;fAtuσEUEf8::F,F0tF0랅tFP1EfFL묃EUD1Fd1V1FG1F81F )1F1F 1F1F 1F$f?tRjZ1e[^_]h}j1^_f/f f/t/f 8U1ɉUEEt+1f"1tE/f/t f tNj}+}h|hάAGP(] tGWuPf;S2Suut%hhάAS2ZU U1 hhάAS ZE0 [1E |f-1fDt,fRtJfHtZfAtjfSN0}ulN,N0}uN, f,EEN0}uN,f,ڃN0}uN,уf,ăN0 }uN, 뻃f,뮃f,fCt(fAt+fW<FPf-t}tzFPFPf-tMfNtZfStzfGfEfDFLfFLUD0T<|EE FLf~FLUD0TjjjjEPjPWVefuurh Sh5B PSV h Sh5BޗERPSEPE苕4h Sh~5B蚗WPSV袝1\US]jhAS$C t=Af;t?jhASpC u6SCPՕ1[]h|jǬ1ZYgSCiUWVS =pA]Et~jhAS$C jEPSA+ }xDžDžDžE9f8/tTh hBh5BAhh2BjpAKhxjƫY1[e[^_]PCZvG@PC^fNtDfPtDfQtDfFtDfStGfTtGfWtGfYtJfAtM-MMMځMуM ˃M@ŁM뼁M볃M7C[CPC$CYtX7CZlf-b@PC[fAtkfHtqfStwfR5&fAtfHtfSu덃넃xfRnb @;tM=AtM11;]N1E@Y&%Ph{dMf/tAf-t;RCZt44PC_XUvCQfz:uhPR/E 뽅x&Phz^P7[1^EUWVSX]jhAS$C tYjEPS1A螄 E;]}JhA4hCYZ!Ef8/t!thwj聨XZe1[^_]ÉC뱃tg}tlhCYaX_Ej(P~s f}]SC_f|ESCYfDEBPhA[XZ^]j(S$s AY_u+f}tQ]SCZf|Ew>SCfDEXՉG)PhAhh AhAh Aj腍먍E/u hCv`_qEu/VjK^UWVS}fDAhjfP臘jhAu$ChQh=AhAL hPhA =\a\}DžL1;\ojwShApC ufLhsj]1[^e[^_]Ë\hYh=APW{\PhAd\]jShApC uLFFPjSh.ApC u LjShApC u LjShApC u LjShApC u L jShApC t%jSh"ApC TL@GL@9DžLhh=AWHEjPuӀDž<DžDDžH8E@<;U28(f/t)D+f(HjRCYvW(CPCZfNtuv#fYtvfZfVtTPjeYfBt5vfDu働L@<5f-t=fAuLځL΃LŃL뼃L LSC_v(@PC^fYuL߃L@rLcDžP8DDždDžTDžX,HDž`4H42C[jP4h0蜈,j+2 CZY}h(APC[^jh,AW$C ijh(AW$C PjWP C ji}]8EhAjfj*6 CZYt!H8j*4 C[_62Yt/8Hj*3 C_Zu32YHDžP DžP(AH8jDRPW8CDA4fz:ehPR; fPh Pjh,AW$C sDž`jh(AV C,j,2 CtM,h,A08Cjh0AP$CH DžTDž`VCZjPhV,j*S CY^j*S C^ZhPP诅SCYfE*SCZfE\j\S0CPPCPCYHfE\{fDŽEHۃ,2jksP8A9B f:hPV9i,0CZt*,jPh2քDž`,fz:uhPR9Dž` hS/^rSCYfE\th8ASCXZhASC[^>SR/YHSCZfE\1h8ASC[^SCYfE\9DžX^PCZH~fE\t fDŽEHjVY[FRhASCZYuWhPVXu`dhQV9_X188J@1hASCY[thuSPCh:ASCubXuij*S CYZRf*f?ff9)S-Zu/PPCY[PSCPSCTL L@P?TLPPP\'hA0P蔁RPNR A(S4f9fffPSC[Zh@OYAPH,ZTPhrKOje ULu L H,dj+2 CY[tPhХALXZ,j*0 CY[uUSjhAu$C EAf8PCYHEPEP8[ZAAS@FUЉ%9rh`Au8CZYyRFhqj蘘L CjfEPS1Y[]j hLAuCYZxhPAuCYZ~RhTAuCYZxhXAuCYZ~AhbAuCYZxRh\AuCYZ~$EfW Ef7PS1"ZFtúA)?R9vfx"uۃSVhA݂ lfǃAefGl{fG:…XjPhjhARzffffj\St C_ƅXtfSCtYDBU9WStCxPWOw_p@ZtXfh p(wSCtYDBU9StC_XtCtBf\^hA}u$jRhhAvAvAPRCY[PShC_Z% f@Aptwh@tQx1AAA-t AfAB uAAAfA hhlhj.t0ChY[hhthA%f GuVPu]SVujSWGf pSV/Fxf $dd``h|AWCthAVhAjS"\1CUWVS}j]u hDAWG Eh^APCUY[B9t~fXhAS4CjkhDAVCEEtghAVPu[tXEtwuEU f$tS;]fUjehDAu e[^_]jnjthDAujuhDAuEPBfv f*to;]f$EiuDžt$h^AOVChA4FV4C4FPh^A C_Zu;]sff؋UuE;]sff uf fChhDAuhhDAuUWVS\j]WURP3XfEM Uċ}fBEfBEfUfE11j5A@^DžXEP U[fEf&~:f.=fMfrJfCDž]ftj5Au u e[^_]j1EV]jEPj}WMW } jFSjWj5< C4W} t;u |MfqfEfDtgfK (Ef8u=1U E9DžfMYfUujXZ E 9=Ai;KEfx BJ9<BJ9WfE@fESG6XgU E9uuCuhA!!EPEPfvYf$8QOf%:SHPzfEHfE[1DžXf f  fq;#EOx;fBAfBf##; uhA EPEP 'f(sC;&J BGJ9 + S@Pk fE@f-AjPAO 1Uf:EEfH AfHj 4DžgUfDz fuU} HPfBHP j Q4` HPfBHP EHfEfBHfEOAhdAfEYHfE/ fua HPfBHP] EHfEfBHfEXEZPEP MDyPhlAlEPEP s  SHP fE;E?T;} fBAfBEPEP| EPhlAEPEP 1Dž1Z fUfME䍝WSPufDž^NU E5SufUfECuC uhA;_ BЙ BËA9hBљҘPRJ 9EPEP _+XKt j 1^EPEP Y[)ٍAE ujHXZU 11E3DžDžfEfU[4BAU E3ujuC BЙ BËA9~ )ٍAuhAOE1PEPDž%U E2uj[YHPfBHPfBHfEEH"j#RB)@PjEfE@fEjYt PCZ9|1Dž4?G3S/EPEPU f21DžE;M yQCfU BQ9Xt uN9~7fIfBMBH9u͋HAfE붋GfBUH9t2BfE~PhAEPEP5uEfE@fEōWBJ9HEHfEEfE@fE15U@VSl<=Aut }#1t j%VRJ e[^]Ã} u =Auh[= At(-hSZYuAj -[j"Yuj%VShA!1Z|=4BUSu^tBBtBf tu5=4BtBt&jh4BZYt/f=4BtB4BuftB؋]1ftB4BUtBu ]1ef uUW1VtBStBUEuLtBfBe[^_]Ã}tTjSCZYt5tBuf t1f"1tƁBtfSu CZYuCf vGf;]n=BujShtA CZYOf^u{f um됡tB=4Bt @ttBf<f>uf)uf(uftB(tBf)uftB)tBf&tzf|ttCf ftBtBff9Ff&f&؉uCf wrfceftBtBPf9tBuftBtB4f<l1f>[f`UWVStBBf vRff=tBEtDE8Bt{0tBf=tBt@Ef?10AHt061[EfxUWVS AuH}hA1uCUY4BX)9UzPhA CYZG؋E ËESPhʼAhhAhAh Aj= uCu ChhADPh<G`fufZ AEEf/4fx:1jRCY_PhA C_Zf"1u볋f<t! bWPupC uu<Cu <ChA6<hCtjPCZYtSVhhA<\E ËESPhAh@hAhAh Aj!< ? Ef8fVWӉXZUB,<I1mhCjQhxAW bj EPV> ‹Ef8uRhhxAW]hhxAVMUB9B2Ye[^_]VXj]>V9Zj EPVX> ‹Ef8u9AtVjnhxAVVj*V C t%1PV3,P3j?V CY[uV'3@NVW[ZNjEPV= ‹Ef8|9uj$AU1ҋ@P=AUSt/=Au&x t= At""3j YX3n]Zj XUWVSh}UDž=A|(A;BhUEU]M)ٍ@9wQSW<E+Efj?W CWP1[fj\W0CZYt t^=Au!(A;BuPVa1uV_1 j*W CY[ln2B$uhASCYZthASCYZ^SCXZ9e[^_]UWVS`]f{\t f\fShASCP90 t!u&N(A;BtIW0e[^_]hAVCZYthAVCZYu=Au맍PW/uVSP U@WVS&Ed]p^Dž48hhrAj 0(A0MfABfBEB Q(AAA~jShP/8ٍCPE4[09(AchhrA0hhrA84e[^_]hhrA8o Dž4΋UBE0f"f'1Dž\ADžX;DžDDž@DžTDžP"DžL'EtZf9tUf Dž\ADžX;DžDDž@DžTDžP"DžL'T(AH@(AAB u(AdP 8f;PFf;L9UDž4UE=Ef;P2f;L]EfuhDAu|C ƋEfd)VHCYHqDH`j S CXZtf`N=AU(A;B뱃EjhAPpC uwM\M]t2f9f tCEhAS4CY_CEuEf90fEf9WfjhAupC u UBEBXxB jhAupC jh$AupC EDž@E!f9f*j}WPJ5 ~mEf8-tOٺ)‹E @f8,uUEjEPE P4 ~ DjWP4 9؉} u5늋Ef8*kEDžTVjh4AupC u]CECPCZfquCEDžP'DžL`8PEC8_Dž4BEUf9fEhhrAP HUf9fEhDAPCY^td%SHLCEPDž4YuDž4<\S4CXCf9 XZ@d=AV,pjPCZYtf>"t;VĻPC_XĻPfK^tAApj"V0CY[tf^9s jPCYZu僽t%VĻSCG)PSCph6AV,C[ZuɍĻSVZYtFf"PS4hgj:AAj_P?S[^hFAYuh^AZuhh9@hFA^_>j$(j jP!h>hA5|B5AFAe[^_]h9h^Ah.AhRAhohxAlhĿAbU@WVS AuuAjhAV$C tVj%SVܵ uPAe[^_]ÉԺPh8Aj,hAhJAh Ajh[j91^_jPCY[t1tCt 1f;"1-jPC_Zu#Ph0A CZYu1f;"ƒSC{DPSW)ff>:tjWV A AtBf tjRVAP5AU@WShhAj  1C h.AhtBhCZYt'hbAhtBhCY_uiK0A{uPKA10AtBf/f%hhAhtB C0A1khhAhtBhC_ZuKhnAhtBhCZYuPK{u0AtBf/t/f%t)htB2hhAhtB1 CmKэBu!f=tB%tSKX_1ۍe[_]À uhtBCYuftB0AfC1htAhtBhC_Zu0A(u10AB BtDHj9tf htBCUYG9>htBW謷XZfhhAP! 0AC15hzAhtBhCS"UWVShHhAj 11F hAhtBBhCtDhAhtBhCY_tZKu?F<4@AhtBhC_ZtEFՀN0A1dVy[1e[^_]ÀN0A1810A(HuhkhAhtB FhAhtBhCZYuvCxwhrhAhtB AF1jhAhtBpCt+F< 4@AhtBhC[_t#Ff=tBthxhAhtB)10A3HhV;UWVSEUEƍC |$SuW$ڃ UfUtgfHfwUf=PhA C^ZtEfx=EPhA CY[tEf9XU乸AUhP@EEZtJEUEUe[^_]fBHfvU=ttUEu;1PfHfw"fx=pPfHfwU뮍UatSf=tVf>t`ftVh*1[e[^]ËMeEtPhA CZYt Ef9XtEU E뷋M}1UWVS E0uf(t!CЃ vwSCZu~f_txh=fBHfvUEUEEf)thS1^xEUfHfw\jEPVv! ۉlF\$VuSP!f3u u1 Ee[^_]UVSuEPhA CY[1ۅtEfBHfvUUE1҅t$f-t:f~t/f!tEU Ee[^]1}EU]UWVS]jhAS$C tBfwhj.1ZYe[^_]ÅtDjhASpC tmjhASpC GSfHf9Ɖtf=tS6XSC\CXV S膩SXfHfwUf:t(UE]u&A#1(hXڃ=AuuhA^_‰贷j=P CY[f蒷PhAhSfuASV(t1WVSpC tSC\CXVCFXS-XDžVhY{A=UWVS,EEM] EUEƉUM߅u(9ȉUEEЋUԃ,[^_f9]vMЉ]ԋEЋUԃ,[^_ÍvEE +E܉EUMEM ËEME̋uUM Љe9)ӉڊMM ‰U]ԋEЋUԃ,[^_fEtUE1uf9]r"E9EvvEEЉ}ԋEЋUԃ,[^_ËM+M}M+Ek9r`UWVS$EEM] EUEƉ׉M]u$9vLE1M؉E܋E؋U܃$[^_;UƒEu4;UrM9Mw{1fEtuEËE륐 +uME Nj]MEU ЉEԋU׉9r:t)1Sv11Gv1uzEM9sˍvN1Q=r -) ̋@UWVS$EEM]u} ȉڅEEӉuu"9wJ}ËE9v811M؉E܋E؋U܋Mt؃ڃ$[^_fE1ύvƒEt} +}ME ‰Uԋ]MU ЉEЉuԉ׉E9rotaM1nfUȉ؃ރE9r M9M01(1uEM9sMI1UHBhB5LBBhxBhhBhXB$CBf=@MZUTBXB\BBt)B=BCu,j*=BtW1á<@@8PEtY1Bj$h4C| C CB=0BZthA CXB둍P@f= tf= uzlv z\vpUWVSLjDj]S =Bu.dXjSh Ct9h@S1ۡ CH C8B CH=AthA[xdhrA=BdC1f f;"j,CYqDh0Ch 0C C8CXZFh0Ch0C8C^ C_1jh C(jjjA3ruHfwM EtEh@SP膞 =BHB=8BHBe[^_]áXBEP5hBYENjU9U}6f8tBSUS6PE‹ExB(C=hB5xB5hB5XB05HB0CAUBD]UB+]UES=v=t;=tq1=u=r1ҋ]=t#=t?1jjZYtStjjj ZYt tj Ѓ+jj jjZYttjjjY[jjXZl_1ÐUu uAZYUu uAZYUu Uujc U1W}QYt uPJXZ}UUE t jPR# PZUU VuS]t'wPhAR wStjVhA| e[^]Uu ujjh AUWVSuE EkE=, PUAL@"XXME@UD9f vqf"f\g!AtjAPh(AS؃e[^_]Éf8t)?E>,Ef t-f tBf^Cw6E\Cn\Cr0\Ct\C"\C\\Rh.APO "C}~C.CC.C.@)PWAY[/UWVSuM ɉ=, PEA"ǍPXKCMD9 "\, <^|A\BxBȃ|ABv!AtjAPh(AS&؃e[^_]1I1,& t( t k B\Bn\BrF\Bt\B"\B\܅"B~B.BB.B.@)PWAZY`USjhByuÃ4ȵB$ZYtȵB]UE PuEAZYUEW}VuSv*Wuh7A=u VAY^Íe[^_]4lAh3AXZWuh7Aà tUSE hEAuuhPt=@PSAXZ؋]ƃUE @PuPYZUWVS-E1ۊ<+<-hMASLY^4҈U봉뽋M1 lAM܃})эQ9uRuS t Eԃ}u'}+t3MԸEpEF>u$}H]MԸE>hPAV _Zu6"A ]ĈA븋EUUHB EEUMHB땊Uă1]AUIpKMEE9ETAKh0A h;APHB0B1ۍCOldHandle == INVALID_HANDLE_VALUE./base/shell/cmd/parser.c./base/shell/cmd/misc.cdel in ./base/shell/cmd/history.c: returning item is 0x%08x (Bottom is0x%08x) ./base/shell/cmd/history.c./base/shell/cmd/dirstack.c./base/shell/cmd/setlocal.cExitBatch ./base/shell/cmd/filecomp.c%s - %s %s. %s %s %s -- %s %s *.*CreateFile %s - %sGetFileSizeEx %s - %sHeapAlloc - %sReadFile %s - %s%04d/%02d/%02d %02d:%02d:%02d%c %c%c%c %s PrintElapsedTime(%d,%d)./base/shell/cmd/timer.coffon ^&+-*/%20151211-rUNKNOWN0.3.11ReactOS ReadBatchLine () ReadBatchLine(): Reached EOF! ReadBatchLine(): textline: '%s' CommandEchoserr: '%s' ./base/shell/cmd/echo.c/?%sCommandEchoerr: '%s' CommandEchos: '%s' checking mode ./base/shell/cmd/copy.cgetting time ASCIIBINARYcopy: flags has %s TEMP.decryptopening/creating SetFileAttributes (%s, FILE_ATTRIBUTE_NORMAL); DeleteFile (%s); opening/appending setting time appending ^Z setting mode PROMPTWindows 98Windows 95Windows NT Version %lu.%lu%-10s*Full filename: %s ./base/shell/cmd/del.c%I64d%% %s 100%% %s SearchForExecutable: '%s' PATHEXTPATHSearchForExecutable(): Loaded PATH: %s ;enableextensionsdisableextensionsenabledelayedexpansiondisabledelayedexpansionONOFFKERNEL32/D/H/JCreateSymbolicLinkWCreateHardLinkWMKLINK./base/shell/cmd/for.crd cd "cdtimedaterandomcmdcmdlinecmdextversionerrorlevelSOFTWARE\Classes./base/shell/cmd/assoc.c%s=%s <JUNCTION><DIR> %-12s%10s %-6s %*s%s %s GetDiskFreeSpaceExW./base/shell/cmd/dir.cDEBUG: Cannot allocate memory for ptrStartNode! DEBUG: Cannot allocate memory for ptrNextNode->ptrNext! DEBUG: Cannot allocate memory for ptrFileArray! %s\%s [%s]%-*s%-8s %-3s %*s %s %s A:\Copyright (C) 1994-1998 Tim Norman and others.Copyright (C) 1998-2009 ReactOS Team%s - %s/t: %s '%s' ./base/shell/cmd/time.cMINMAXAFFINITYBLOWNORMALHIGHREALTIMEABOVENORMALBELOWNORMALSEPARATESHAREDWWAIT./base/shell/cmd/start.cCOMSPECcmdcmd.exe.bat.cmd"%s" /K %s[BATCH: %s %s] [EXEC: %s %s] Error executing CreateProcess()!! cmd_shift: ('%s') ./base/shell/cmd/shift.cdown./base/shell/cmd/replace.c SourcePattern: %s SourcePath: %s SourceFile: %s./base/shell/cmd/ren.c DestinationPattern: %s Destination Path:%s Destination File: %s Found source name: %s DestinationPath: %s %s -> %s @@@@@@@@@@@@@@@@$P$GBackup privilege enabled Enabling backup privilege failed cmd_pause: '%s') ./base/shell/cmd/pause.c./base/shell/cmd/path.cPATH=%s /N/Y/-YDestination: %s ./base/shell/cmd/move.cSource Folder: %s TRUEDo we have only one file: %s Found file/directory: %s Source is dir: %s Destination is directory: %s Destination is file: %s Move Status Flags: 0x%X %s => %s GlobalMemoryStatusEx/bRDMDFile: %s Creation: Last write: Last access: GetFileTime: %sAttributes: 0x%02X ASHRHeapAlloc: %sGetKernelObjectSecurity: %sConvertSecurityDescriptorToStringSecurityDescriptor: %sSecurity descriptor: %s cmd_if: ('%s') ./base/shell/cmd/if.ccmd_goto ('%s') ./base/shell/cmd/goto.c:eof%s %s: %04X-%04Xcmd_for ('%s') CommandEcho: '%s' 0x%08x %s Wrong address %s DIRCMDAttributes mask/value %x/%x (B) Bare format : %i (C) Thousand : %i (W) Wide list : %i (D) Wide list sort by column : %i (L) Lowercase : %i (N) New : %i (O) Order : %i Order Criteria [%i]: %i (Reversed: %i) (P) Pause : %i (Q) Owner : %i (S) Recursive : %i (T) Time field : %i (X) Short names : %i Parameter : %s Failed to build full directory path/m./base/shell/cmd/date.cCOPYCMD/A/B/V/Z++,,\\.\09afF/-F/-f/s/d%I64u %s if /I not %s else for /D /F /L /R %%%c in (%s) do %c%s%st A A AY AY AY AY A AP A/S/D/C"BA8AAAAAAAA%%d redirected to: %s /c/n[%c,%c]?%c ErrorLevel: %d ./base/shell/cmd/choice.cGC_TIMEOUT elapsed %d msecs GC_NOKEY GC_KEYREAD read %cexiting wait loop after %d msecs ./base/shell/cmd/alias.c  %s &|<>rem /?Batch: ('%s', '%s', '%s') hFile = %x Batch: returns TRUE DoCommand: ('%s' '%s') +,/;=[].:\echoExecute: '%s' '%s' ,;=/:[EXEC: %s] NtQueryInformationProcess failed with status %08x Couldn't read virt mem status %08x bytes read %lu [ShellExecute failed!: %s] |EAEAEAEAEAFA@FAGAtEA.JABJALJANJA8JA$JA delims=eol=skip=tokens=usebackrSOFTWARE\Microsoft\Command ProcessorAutoRunCONOUT$ntdll.dllNtQueryInformationProcessNtReadVirtualMemory[command args: %s] \autoexec.bat/T::OFF"&<>@^|cmdexit.bat\cmdexit.bat(C) Copyright 1998-2009 ReactOS Team.Modifications by Didier Stevens https://DidierStevens.comcmd_call: ('%s') ./base/shell/cmd/call.c/F/L/Rindo/Inot,;==else*/%+-&^|<>%i!~-/P?aliasassocattribbeepcallchdirchcpchoiceclscolorcopydeldeletedelaydirdirsdllinfoprivilegeechosechoerrechoserrendlocaleraseexitfreegotohelphistorylabelmemorymdmkdirmklinkmovepathpausepopdpromptpushdrdrenrenamereplacermdirscreensetsetlocalshiftstarttimertitletypeververifyvolblablugrecyaredmagyelwhigra23456781011121314151aqupur @SearchForExecutableSearchForExecutableSinglePrintElapsedTimecmd_timecmd_startcmd_shiftcmd_renamePerformRedirection@@cmd_pause&||&&|definedexistequgtrgeqlssleqneqܫAAAAAAAAAA&A<>>>cmd_movecmd_ifdelcmd_gotocmd_forCommandEchoserrCommandEchoerrCommandEchosCommandEchoCommandDirDirListADeleteFilescmd_datecopyConInKeyInitializedra hscotldpnxfsatzDoCommandExecuteIsConsoleProcessRunFileCommandChoicecmd_callReadBatchLineBatchExitBatchFindArg(null)#%04x%04x%s:(%s:%d) DEBUGCHANNEL+-allfixmeerrwarntraceTAZA^AcA0123456789abcdefAThe result is too small to be represented (UNDERFLOW)Unknown errorArgument domain error (DOMAIN)Argument singularity (SIGN)Overflow range error (OVERFLOW)Partial loss of significance (PLOSS)Total loss of significance (TLOSS)_matherr(): %s in %s(%g, %g) (retval=%g) A AAAAABPBpseudo_relocation protocol version %d is unknown to this runtime. Unknown pseudo relocation bit size %d msvcrt.dlllongjmp@C@CPB 0Cx|%t'(((L(Xh .>Nbv ,>P^x&@Nj|,DXn$4BVfv"2BZp *6FT`v ">Pf  ( 8 H b r       !!"!2!L!b!x!!!!!!!!!""&"4">"H"T"\"d"l"v"""""""""""""###&#.#8#@#J#T#^#f#p#z##############$$$$$.$8$D$P$\$f$p$z$$$$$$$$$$$$$$ %%$%0%h .>Nbv ,>P^x&@Nj|,DXn$4BVfv"2BZp *6FT`v ">Pf  ( 8 H b r       !!"!2!L!b!x!!!!!!!!!""&"4">"H"T"\"d"l"v"""""""""""""###&#.#8#@#J#T#^#f#p#z##############$$$$$.$8$D$P$\$f$p$z$$$$$$$$$$$$$$ %%$%0%AdjustTokenPrivilegesPConvertSecurityDescriptorToStringSecurityDescriptorWGetKernelObjectSecurityQLookupPrivilegeValueWOpenProcessTokenRegCloseKeyRegCreateKeyExWRegDeleteKeyWRegEnumKeyExWRegOpenKeyExWRegQueryInfoKeyWRegQueryValueExWRegSetValueExWAddConsoleAliasW AllocConsole Beep7CloseHandleJCopyFileExWKCopyFileWQCreateDirectoryWYCreateFileWiCreatePipenCreateProcessWDeleteFileWDeviceIoControlDuplicateHandleExitProcessFileTimeToLocalFileTimeFileTimeToSystemTimeFillConsoleOutputAttributeFillConsoleOutputCharacterWFindCloseFindFirstFileWFindNextFileWFlushConsoleInputBufferFormatMessageWFreeEnvironmentStringsWFreeLibraryGenerateConsoleCtrlEventGetCommandLineW!GetConsoleAliasW$GetConsoleAliasesLengthW%GetConsoleAliasesW&GetConsoleCP7GetConsoleMode9GetConsoleOutputCP;GetConsoleScreenBufferInfo>GetConsoleTitleWDGetCurrentDirectoryWEGetCurrentProcessFGetCurrentProcessIdIGetCurrentThreadIdKGetDateFormatWTGetDiskFreeSpaceW[GetEnvironmentStringsW\GetEnvironmentVariableA]GetEnvironmentVariableW_GetExitCodeProcessgGetFileAttributesWkGetFileSizeExlGetFileTimesGetFullPathNameW|GetLastError~GetLocalTimeGetLocaleInfoWGetModuleFileNameWGetModuleHandleWGetProcAddressGetProcessHeapGetStartupInfoWGetStdHandleGetSystemTimeGetSystemTimeAsFileTimeGetTickCountGetVersionExWGetVolumeInformationWGetVolumePathNameWGlobalMemoryStatusHeapAlloc#HeapFree6InterlockedCompareExchange8InterlockedExchange9InterlockedExchangeAddCIsBadReadPtr_LoadLibraryAbLoadLibraryWeLocalAllociLocalFreelLocalReAlloc}MoveFileExW~MoveFileWMultiByteToWideCharQueryPerformanceCounterReadConsoleInputWReadFileRemoveDirectoryWResumeThreadSearchPathWSetConsoleCPSetConsoleCtrlHandler SetConsoleCursorInfo SetConsoleCursorPositionSetConsoleModeSetConsoleOutputCPSetConsoleTextAttribute SetConsoleTitleW$SetCurrentDirectoryW,SetEnvironmentVariableW0SetFileApisToOEM2SetFileAttributesW3SetFilePointer7SetFileTime=SetHandleInformation@SetLastErrorCSetLocalTimeJSetProcessAffinityMaskNSetStdHandle_SetUnhandledExceptionFiltercSetVolumeLabelWkSleeppSystemTimeToFileTimesTerminateProcessUnhandledExceptionFilterVirtualAllocVirtualFreeVirtualProtectVirtualQueryWaitForMultipleObjectsWaitForSingleObjectWideCharToMultiByteWriteConsoleInputWWriteConsoleWWriteFilelstrcmpiWlstrlenW^__dllonexitj__lconv_init__set_app_type__setusermatherr__wgetmainargs__winitenv_amsg_exit_cexit_fmode_initterm_iob@_itowE_lock_onexit_pclose_snwprintf_stricmp_unlock_vsnprintf_wchdir_wcmdln_wcsicmp_wcslwr_wcsnicmp_wcsnset_wcsupr_wfopen_wgetdcwd _wpopen:_wtoi?abortJbsearchTexitWfclose_fgetwscfprintfifree{isalnum|isalphaiswctypemallocmemchrmemcmpmemcpymemmovememsetqsortrandreallocsignalsprintfstrchrstrcmpstrcpystrcspnswprintftolowertouppertowlowertowuppervswprintfwcscatwcschrwcscmpwcscpywcscspnwcslenwcsncatwcsncmpwcsncpywcspbrkwcsrchrwcsspnwcsstrwcstokwcstolwcstoulLoadStringWMessageBeepDbgPrintRtlAssertvDbgPrintExWithPrefixadvapi32.dllkernel32.dll(((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((((msvcrt.dll<<user32.dllPPPntdll.dll|nAnAAAڀADkV0  DkV0H`x      8PhDkV DkV DkV DkV( DkV8 DkVH DkVX DkVh DkVx DkV DkV DkV DkV DkV DkV DkV DkV DkVDkVDkV(DkV8DkV &'() * + , - . / 3 DkVH X hx !"DkV( 8 HXhx !"DkV  (8HX hx!"DkV  (8 HXhx!"DkV   (8HXhx!"DkV   (8HX!h"xDkV   (8!H"XDkVh x  !("8DkVH X hx !"DkV( 8 HXhx !"DkV  (8HX hx!"DkV  (8 HXhx!"DkV   (8HXhx!"DkV   (8HX!h"xDkV   (8!H"XDkVh x  !("8DkV H X hx !"DkV ( 8HXh x!"DkVDkV DkVDkV DkV(n (z(h(zX(D(((>(R (^(fH@p(2@ H0 h `((>0MU\hbNXeJh4knqt|w"z|J8 <$RlN@@<LT܍>Rp@JHD>@ďF *8*d*****@*l**đ***H*t>"ؔ"ܘ@ L lD<@0Tdи`P\<  `hP~|&f (R|ztlB&vPlDppdLD L LL2 !#%((x(d*x*xT+(-x-t/n@T8RcL`sܕL 0 <^    # ,  5 .= PF JN |V 2] Pf n Fv  J̇ ' +| n+ (|/ &|V ,L &( #  ( (; 'b 'x &T n ľ l  0  0 L p  h P- 8 0 F S 0 ` u  ^ (4 0    d   p0* ; M _ `x H j " 8 *<  P"n2dJD4cz<8tt rxT+vD=z I@\lxl~`̐T Z"|8 2" %Af bj240d (F R \^ l ,x\  h  X ܴx^ DX d~x<ll,( .20.20.20.20.20.20.21'90/98576455454454454454454454454454454454455798'98+6,.21.20.20.20.20.20.20.30.21.20,65132.10,/.+2, .;; 777 333 /// --- ***)0)'94277555444444222111111111111111111111222333444444666*77(4,)-)+++... 111 666 888 &94 ,-- .0/021354353/21/21.31.20/20*5+465.1/,.- ,94 444 ... )3).77333000---*7-.55222000///-/-,6.+55+33222111111000////////////......////////////000111222333*44+52,3,...000111444)62,2,...111555'90,,,000 777 /54 -/.133,65.20.21.21.20.21353132,.- 5:5 111 ,,,+84222...*4.033111-3-+50033000.3.,50-33111 000!.0."-5-#,31$+22%111%111&000'010'/2/'.3.(.4.(.4.(-4-)-4-)-4-)-4-(.4.(.5.(.1.(/2/'000'000&111&.22%,22$-40$.5.#///"111!022 ,44-6-///111/44,6/...111,53+2+000155)1.--- 666 /5/ /00566/21/21.21.30.30253132-5- 166 --- ,55222,0,,52111-0-,41111.0.,42/11 ///"-4/#-22%111&/2/'-30),22*111+010,/4/--30.,22/.11000000101/3/2/4/2.3.3.303-213-224-224-224-224-224-224.303.3/3.3.3/4/2/2/100011110,11/-22..3.-/3/-000,.11*-33).4.(000'011&,31$.2.#000!-22 -5////022+3.////22*4-///155*//111 333 +4+ 466.21.30053053,76+4+ .33 /// -62/22,0,.41///+3./22.0.-31/11 /4/".31$/00&.3.(,21)/11+/3/--31.-1100201.3.3-224.1150206/3/7.218-119.00:030;/4/-11>-11?-11?-11?-11?-11?-11?-11?-11?.22>.21>/30=/3/DA-11?/20@/3/B.20C-11D.10E030F/3/G.20H.11H.11I-11J-21J-21J.20K.30K.20K-20J-21J-11J-11I.11I.22H/2/G/3/F030F-00E-11D/30B030A.00@-11>/30=/2/;.11:.3/8/3/6.115.3/30101.22/.40-/21+.31)/3/'/11&-31#020!-31.00033/2/.00,2//3//33,11.3. -5- 9<::?<HNJEKH:FD:<;.3. -2- 030/3/141.00.11/11-20.20 /31"-21%.10'/20)/21+.2/-/100/2/2-214/106.3/8.11:/3/<.21>.21?/3/A.21C.10E/3/G.21H.11J/3/K/20M.11N-20O/3/Q/2/R.11R.11S.21T-30U.30U030V030V030V030V030V/30U.30U-30T.11T.11S/20R/3/Q.30P-11O.11N/3/L/30K.11I.2/H/30F.11D/20B/30@.11?/30=/10;-219/3/7/115.3/3/101.21//2/,/20*/30(.11&.20$.20!.20/1//11.11-30030/3/.33,11 333 =@?CIEEKHPWSOVR7A8000 +50 000.52-11/1/.11-2//11.1/ .20".20%/20'/21*.21,.20//301.303.106.218/21:/20=.10?/30A.20C.20E/20G/21I/20K.21M.20O.2/Q.10S.30T/2/V.10X.21Y.20[/2/\/11].21^.30_.20`/2/`/2/a/2/a/20a/2/a/2/a/2/a/20`-20_.30^.11^/10]020[.30Z.11Y/20W/30U.11T/2/R/30P.21N/20L/20J.21H/20F.20D/30B.10@.20>.2/X^[vLRONTQNTQMTPMTPMTPMTPLTPMSOLSOLSOLSOLROKRNKRNKRNKRNKRNKQNKQMJQMJQMJQMJPMJQMJPMJPLJPMJPLIPLIPLIPLIPLIOLIOLIOKIOLIOLIOKIOLIOKIOKIOKHOKHOKHOKIOKHNKHNKHNKHNKHNKIOKIOKHOKHOKHOKIOKHOKIOKIOLIOKIOLIOKIOLIOLIOLIPLIPLIPLIPLJPLJPMJPLJPMJQMJPMJQMJQMJQMKQNKQNKRNKRNLRNKROLRNLSOLSOLSOLSOLSPMTPMTPMTPNTPMTPKQNQXTyQWTATZWY_[U[XOVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVRQXTTZW _fb U\XOVROVROVROVROVROVRPWSSZVSZVSZVSZVSZVSZVSZVSZVSZVSZVSZVSZVSZVSZVSYVSYVSYVSYUSYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURYURXURXTRXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTOVROVROVROVROVROVROVRRYUW^Z bhe!OVROVROVROVR`fc{jpmX^[OVROVROVROVRX_["\c_3OVROVROVR]c_tywV]YOVROVROVRU\X4cjfQXTPWSPWSsxu`gdOVROVROVRX_[hnkRYURYUQXT~v|zrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqwuotrswuv{yz~}~u{yrxvrxvrxvrxvrxvrxvrxvy}ekhOVROVROVRW^ZZ`\bSZVSZVmsptyxrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvmsqkpnotrswvw{y{}~rxvrxvrxvrxvrxvrxvrxvrxvrxv|]d`OVROVRRYUcbheU\XT[WV]YrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvnxYWWYnxrxvrxvinlimklqoqwusxvtzxu{yw|zx}|z}{rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvz~QXTOVROVRW^Z`gc[V]YU\XrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvZKْKْKْKْZrxvrxvgljejhjnlrxvqwuqxvrxurxurxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvkqnOVROVRU\X\W^ZW^ZV]YrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvXYܚKْXrxvrxvgljchffkiqxvrxvrxvrxurxvrxurxvqxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvsywOVROVROVRahdX_\X_[iolrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvKْXrxvrxvgljchfdigrwvrxvrxuqxuqxvrxvrxuqxurxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxv\b_OVROVRW^Z_fbY`]Y`\rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvtKْ[rxvrxvgljchfchfrxurxvrxuqwvrwvrxvrwuqxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvx~|jpmOVROVRT[W ahd9Za^Za]sywrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvo~xqY[o~xrxvrxvgmkchfchflqolrpmsqotspvtrwusxwuzx~~rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvtzxpvtOVROVRU\X:cjfO[b_[b^uzxtzxtywsywsxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvkpnchfchfchfchfdighmklpnotrsxvw{y{}~y~|rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvv|yOVROVRV]YPelhS\c`\c_v|zv{yu{yuzxtzxtzxsywsywrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvpvtejhchfchfchfchfejhimklqopustxwx|zz~|sxwrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvx}{OVROVRW]ZTgnjS]da]d`x~|w}{w}{v|zv|zu{yu{yv|zz}rxvrxvrxvrxvrxvrxvrxvrxvx~|OVROVRW^ZTholS^fb^eaz}y}y~|x~|x~|w}{sxvrxvrxvrxvrxvrxvrxvx~|OVROVRW^[TjpmS_gc_fb|{~{~z}z}~~~~~rxvrxvrxvrxvrxvrxvy|OVROVRX^[TjqnS`hd`gc}}||}375                                                                                            375}rxvrxvrxvrxvrxvy}OVROVRX_[TkroSaieahd~~}8<:                                                                                              ,2/rxvrxvrxvrxvrxvz}OVROVRX_[TlspSbjfbie                                                                                                rxvrxvrxvrxvrxv{~OVROVRX_[TmtqSckgcjf                                                                                                |~rxvrxvrxvrxvrxv{~OVROVRX_[TnurSdlhdkg                                                                                                |~rxvrxvrxvrxvrxv{OVROVRX_[TovsSemieli                                                                                              |~rxvrxvrxvrxvrxv|OVROVRX_[TpwtSfnjfmj     %%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%     |~rxvrxvrxvrxvrxv}OVROVRX_\TqxuSgokgnk     %%%%%%%%%%%%%%%%%%%%%%%%%%%%3#'M.'M.'M.'M.(M.(M.(M.(M.(M.(M.(M.(M.(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/(M/'%%%%%&&&&&&&&&&&&&&&&&     |~rxvrxvrxvrxvrxv}OVROVRY_\TryvShplhol     ''((((((((((((((((((((((())):'.Y5?hEFoLFoLFoLFoLFoLFoLFoLFoLFoLFoLFoLGoMGoMGoMGoMGoMGoMGoMGoMGoMGoMGoMGpMGpMGpMGpMGpMGpM7b>.Y5-!* *!*!*!*!*!*!*!*!*!+!+!+!+!+!+!+!+!+!+!+!+!"     |rxvrxvrxvrxvrxv}OVROVRY_\TszwSiqmipm      ) ) ) ) ) ) ) ) ) ) * * * * * * * *!*!*!*!*!*!*!*!*!*!*!;)/Y6ĥns/[7/#,",",",",",",#,#,#,#,#,#-#-#-#-#-#-#-#-#-#-##     }rxvrxvrxvrxvrxv~OVROVRY_\Tt{xSjrnjqn     !* * * * * * * * * * * * * * * * *!+!+!+!+!+!+!+!+!+!+!+!<).Z6ĥns/Z7.#,",",",",","-#-#-#-#-#-#-#-#-#-#-#-#-#-#-#-##     }rxvrxvrxvrxvrxvOVROVRY`\Tu|ySksokro      ( ( ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) )!)!;(.Y6ĥms.Z6-"+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!#     }rxvrxvrxvrxvrxvOVROVRY`\Tv}zSltplsp     "*!*!*!*!*!*!*!*!*!*!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!<).Z6ĥns/[7.#,",",",",",",#,#,#,#,#,#-#-#-#-#-#-#-#-#-#-#$     }rxvrxvrxvrxvrxvOVROVRY`\Tw~{Smuqmtq~     $.$.$.$.$.$.$.$.$.$.$/$/$/$/$/$/$/$/%/%/%/%/%/%/%/%/%/%/%!@,0]8Ŧou1^93'1&1&1&1&1&1&1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1''     }rxvrxvrxvrxvrxvOVROVRY`\Tx|Snvrnur~~~     &1'1'1'1'1'1'1'1'1'1'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2(2(#C/1_;?kHEqMErMErMErMErMErMErMErMErMErMErMErNErNErNErNErNErNErNErNErNErNErNErNErNErNErNErNErN-O89+4)4)4)4)4)4)4)4)4)4)4)4)4)5)5)5)5)5)5)5)5)5)5)*      }rxvrxvrxvrxvrxvOVROVRY`\Ty}Sowsovs}}}     (3(3(3(3(3(3(3(3(3(3(3(3(3(3(3(3(4(4)4)4)4)4)4)4)4)4)4)4)"A/-W8-W8-W8-W8-W8-W8-W8-W8-W8-W8-W8-W8-W8-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9-X9"B05*5*5*5*5*5*5*5*6+6+6+6+6+6+6+6+6+6+6+6+6+6+6+6++"      ~rxvrxvrxvrxvrxvOVROVRY`\Tz~Spxtpwt}}}     %.$.$.$.$.$.$.$.$.$.$/$/$/$/$/$/$/%/%/%/%/%/%/%/%/%/%/%/%/%/%/%0%0%0%0%0%0%0%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'(      ~rxvrxvrxvrxvrxvOVROVRZ`]T{Sqyuqyu|||     '0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'1'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'3'3'3'3'3'3'3'3'3'3')      ~rxvrxvrxvrxvrxvOVROVRZ`]T|Srzwrzv{|{      ) 4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5)5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*5*6+6+6+6+6+6+6+6+6+6+6+6+6+6+6+6+,"     ~rxvrxvrxvrxvrxvOVROVRZ`]T}Ss{xs{w~~~{{{      ,#9-9-9-9-9-9-9- <.9-9-:-:-:-:-:-:-:.:.:.:.:.:.:.:.:.:.:.:.:.:.:.;.;.;.;.;.;.;.;.;.;.;.;/;/;/;/;/;/;/;/;/;/;/0 >0 >0 >0 >0 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 >1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?11'     rxvrxvrxvrxvrxvOVROVRZa]TSu}zu}y|||yyy     ,#7,7,7,7,7,7,7,,T83c>3c>/\;&H39,8,8,8,8,8,8,8,8,8,8,8,8,8,8-8-8-8-8-8-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9.9.9.9.9.9.9.9.9.9.:.:.:.:.:.:.:.:.:.:.:.:.:.:.:.:./%     rxvrxvrxvrxvrxvOVROVRZa]TSv~{v~z|||xyx     ,"6*6*6*6*6*6*6*+T62b=x~;jE2c=0^:&K39+7*7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7,7,7,7,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8-8-8-8-8-8-9-9-9-9-9-9-9-9-9-9-/%     rxvrxvrxvrxvrxvOVROVRZa]TSw|w{{{{xxx     -#7,7,7,7,7,7,7,+T82c>DrN3c>2`=)O6=.8,8,8,8,8,8,8,8,8,8-8-8-8-8-8-8-8-8-8-8-8-8-8-8-8-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-:-/%     rxvrxvrxvrxvrxvOVROVRZa]TSx}x|zzzwww     3)"A4"A4"A4"A4"A4"A4"A40]>7jDS^7kD6jC/\>&J7"B5"B5"B5"B5"B5"B5"B5"B5"B5"B5"B5"B5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5#C6#C6#C6#C6#C6#C6#C6#C6#C6#C6#C6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D7#D7#D7#D7#D7#D7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E77+     sywsywrxvrxvrxvOVROVR[a^TSy~y}yyyvvv     4)#C5#C5#C5#C5#C5#C5#C50^?7kDέak7lE7lE2bA)O:#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E6#E6#E6#E6#E6#E6#E6#E6#E6#E6$E7$E7$E7$E7$E7$E7$E7$E7$E7$E7$E7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F7$F8$F8$F8$F8$F8$F8$G8$G8$G8$G8$G8$G8$G8$G8$G8$G88,     u{yu{ytzxtzxsywOVROVR[a^TSzz~yyyuvv     3)"A4"A4"A4"A4"A4"A4"A4/\>6jDںpx9mF6kD3cA*Q:"C4"B4"B4"B5"B5"B5"B5"B5"B5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5#C5#C5#C5#C5#C5#C5#C5#C5#C5#C5#C5#D5#D5#D5#D5#D5#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E6#E6#E6#E6#E6#E6#E6#E6#E6#E67+     w}{v|zv|zu{yu{yOVROVR[a^TS{{xxxuuu     1'<0<0<0<0<0<0<0-X;5fA}=nH5gA2b?(P8 ?1=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=0=1=1=1=1=1=1=1=1=1=1=1>1>1>1>1>1>1>1>1>1>1>1>1>1>1>1>2>2>2>2>2>2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?24)     y}y~|x~|x}{w}{OVROVR[b^TS||wwwttt'>4/K?-I=*G:'D7#@4 >1=0-Y<5gAFvQ5hB4eA+U:"C3 >1 >1 >1 >1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?1 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @2 @3 @3 @3 @3 @3 @3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@35*     z~z~y}y}x~|OVROVR[b^TS}}vvvsts1I??]P>\P=[O=[N<[N;ZM8XJAmPDvQT_8nG8mG1_B(N;$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H:%H:%H:%H:%H:%H:%H:%H:%H:%H:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I::.     ||{{z~OVROVR\b_TS~~vvvsss4MCBbUBbUAaTAaT@aS@`S?`SJvZO]ĥϮcn:rJ:rJ5hG,WA'M='M='M='M='M='M='M='M='M='M=(M>(M>(M>(M>(M>(M>(M>(M>(M>(M>(M>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N>(N?(N?(N?(N?(N?(N?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?>1     ~~}}|OVROVR\b_TSuuurss6OEEfXEeWDeWDdVCdVBcUBcUKtZQ_Q_Q__lˮۻq|=uM;sK7lI/\C(O>(N>(N>(N>(N>(N>(N>(N>)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)O?)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@ ?3     ~OVROVR\c_TStttqrr5KBB^RA]QA]Q@\P@\P?[O>[O>ZN>\OCdRGmUKvXN|YM{YM|YeoѴ}?rL7kE.[?"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"C6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6#E6#E6#E6#E6#E6#E6#E6#E6#E6#E69-     OVROVR\c_TSssspqq6NDD`TC_TC_SB_SB^RA^RA]Q@]Q@\Q?\P?\O>[O?_PDgSHpVLyYM|ZM|YO~[nwٽ7mE/^@"E6"E6"E6"E6"E6"E6"E6#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E8#E8#E8#E8#E8#E8#F8#F8#F8#F8#F8#F8#F8#F8#F8#F8:.     OVROVR]c`TSssspqp 9RGHgZHfYGfXGeXFeXFdWEdWDcVDcVCbUCbUCaTBaTBaSA`S@_RCeTGnWKwZO~]O]O]Vcyå9pI2bC&J;&J;&J;&J;&J;&J;&J;&J<&J<&J<&J<&J<&J<&J<&J<&J<&J<&J<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K=&K=&K=&K=&K=&K=&L=&L=&L=&L=&L=&L=&L=&L=&L=&L=>1     OVROVR]c`TSrrrppp    =XMOpcNpbNobMoaLoaLn`Kn`Km_Km_Jm^Im^Il]Hl]Hl\Gk\Gk[Fj[Fj[Ei[EjZLx_ScScRbRbVf=xO6kK+UD+UD+UD+UD+UD+UD+UD,UD,UD,UD,UD,UD,UD,UD,UD,UD,UD,UD,VD,VD,VD,VD,VD,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,WE,WE,WE,WE,WE,WE,WE,WE,WE,WE"E7     OVROVR]d`TSqqqooo!!!!@ZOQsfQsePrdPrdOrdOqcNqbNpbMpbLpaLoaKo`Ko`Jn_Jn_Im^Jp_NyaRdVfVfVeesո>zP7mL,WE,WE,WE,WE,WE,WE,WE-WF-WF-WF-WF-WF-WF-WF-WF-WF-WF-WF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XF-XG-XG-XG-XG-XG-XG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG#F8OVROVR^d`TSqqqnoo"""!?XMOnaNm`Mm`Ml_Ll_Lk^Lk^Kk^Jj]Jj]Ji\Ii\Ii[Ko]Py`TbWeVeXfv¤;sK3eF'N>'N>'N>'N>'N>'N>'N>(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@!A4OVROVR^daTSpppmnn""""?WNOl`Nl`Nk_Mk_Mj_Lj^Kj^Ki]Ji]Kj]Os_S|bXeYfXeamβFzU3dF%K<%K<%K<%K<%K<%K<%K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L<?2OVROVR^daTSooommm####AZPQocQnbPnbPmaOmaOm`Nl`SvcYg]j\j\ir}׻ySaR`My]ChU2UF'L=&K<&K<&K<&K<&K<'L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='L='M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M>'M> @3OVROVR^eaTSnnnlll $ $ $ $GbWZ}oZ}oY|nY|nX|mX{mW{l`qdtβѴsZkYkThMxcIraHqaHq`Dn]7cQ/]J/]J/]J/]J0]K0]K0]K0]K0]K0]K0]K0]K0]K0]K0]K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^K0^L0^L0^L0^L0^L0^L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L&K<OVROVR_eaTSnnnkll!%!%!$ $ HeY]r\q[q[pZpZ~pY~obsfuȪl{]n\mVjOyfMueLudKtdKtcJscJsbIsbCm\4bP0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L0`L0`L0`L0`L0`L0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M1aM1aM1aM1aM1aM1aM1aM1aM1aM1aM&L=OVROVR_ebTSmmmjkk"&!%!%!%!IdY\q\~p[~p[}pZ}oZ}oY|nbsfuft^n]nUiOveNseMsdMrdLrcLrcKqbJqbJpaJpaIpaHo`>gW0\K.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.\J.\J.\J.\J.\J.\J/\J/\J/\J/\J/\J/\J/\J/\J/\J/\J%J;OVROVR_ebTSllljkj"&"&"&"&"HaWZxlYxkYwkYwkXwjWvjWui`oeran^lZjSyeMnaLm`Lm`Kl_Jl^Jl^Ik^Ik]Hj\Hj\Gj\Gi[FiZEhZEhZBfX5[L)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)QA)RA)RA)RA)RA)RA)RA)RA)RA)RA)RA"D6OVROVR_fbTSkkkiji#'#'#'"&"JcY\{o\zn[zn[ymZymZylYxlbqgtؾaoan\kTyfPqcOpcOpbNobMoaMnaLn`Ln`Km_Km_Jl^Jl^Il]Ik]Hj\Hj\Gj[Fi[Gj[BfW2YI*RA*RA*RA*RA*RA*RA*RA*RA*RA*RA*RA*RA*RA*RB*RB*RB*RB*RB*RB*RB*RB*RB*RB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB*SB#E7OVROVR`fbTSkkkhii$(#(#'#'#Nj_cxcwbwbvavau`uhzl|ӷ{hxgwbt[pX~nW}nW}mW}mV|mU|mU{lT{lT{kSzkSzjRzjRyjQyiQxiPxhPxhOwgNwgNvfNvfNvfNveEo^5cQ1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN'N>OVROVR`fcTSjjjghh$ ($($($($Qnch~g}f}f|f|e|d{lp̰wl}k|fz_w^v]u]u\u\t[t[sZsYrYrXqXqXqWpWpVoVoUoTnTnSmS~mS~mS~mR}lQ}lQ|kFtb8jV4gS4gS4gS4gS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hS4hT4hT4hT4hT4hT4hT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iT*SBOVROVR`fcTSiiighg% )%)%)$)$Spejjihh~h~g}nrŨtomg|bzay`y`x_w_w^w^v]v]v\u\u[u[tZtZsYsYrXrXqWqWqVpVpUoVoUoTnTnSnSmR~lGvc9lW5iT5iT5iT5iT5iT5iT5iT5iU5iU5iU5iU5iU5iU5iU5iU5iU5iU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU*TCOVROVR`gcTShhhfgf&!*&*%)%)%Qj`ewdwdvcvcubuatjzn|n|lzixbt]~p\}p\}p\}o[|o[|nZ{nY{mY{mYzlXzlWylWykVxkVxkUwjUwiTwiTwiSvhRvhRugRugQufQtfPteOseOseOrdNrdNqcMqcLqbLpbKpaKoa?fV1[J,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WG,WG,WG,WG,WG,WG,XG,XG,XG,XG,XG,XG,XG,XG,XG,XG%J;OVROVRagcTShhheff'" *& *&*&*&Rlagzgyfxfxexdwdvl|p~p}o}jzdv`s`s_s_r^r^r]~q]~q\}p\}p[}pZ|oZ|nY{nY{nX{mXzmWzlWzlVykVykUykUxjTxiTwiSwiSvhRvhRugRvgQugQufPtfPteOteOsdNrdNrcMrcLqbDj[6`N-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-YG-ZG-ZG-ZG-ZG-ZG-ZG-ZG-ZG-ZG-ZG%K<OVROVRagdTSgggdee'" +' +' +& +&Vpfllkk~j~j~i}qtoi}f{fzfzezeydxcxcxcwbwavav`v`u_u_t^t^s]s\r\r\r[q[qZpYpYoYoXoW~nW~nW}nV}mV|lU|lU|lT{kT{kSzjSzjRzjRziQziQyhKuc=jW2aN1aM1aM1aM1aM1aM1aM1aM1aM1aM1aM1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN1aN(P@PWSOVRahdTSfffdee(#!,(!,'!+' +'Zxlsrrqqpprpnnmmmllkkjjiihhgfffeed~d~c}c}b}b|a|a{`{`{_z_y_y^y]x]x]x\w\w[vZvZvZuYuXtXtXtUrK}j?v`8pZ8pZ8pZ8pZ8pZ8pZ8pZ8pZ8p[8p[8p[8p[8p[8p[9q[9q[9q[9q[9q[9q[9q[9q[9q[9q[-YH     QXTPWSbieTSeeecdd)$!-(!,(!,(!,(\ymutttsrrqqqpooonmmmlkkkjjihhhgfffedd~d~c~c}b}a|a|a|a|`{`{_{_z^z^y]y]y\x\x[w[wZwZvYvYuXuTqI|h=t^9q[9q[9q[9q[9q[9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\9r\-ZI     RYUQXTdjfTSeeebcc)$"-)"-)"-("-(Zujrqqpponnnmmllkkjiii~h~h}g}g|f|f|e{d{d{dzczbybybxaxax`w_w_v_v^u]u]t]u\t[t[s[sZrZrYqYqXqWpWpVoVoVnUnT~nT~mT~mS}lR}lKwf@o]7hU2eQ2eQ2eQ2eQ2eQ2eQ2eQ2eQ3fQ3fQ3fQ3fQ3fQ3fQ3fQ3fQ3fQ3fQ)SB!!!!!SZVRYUekgTSdddbcc*%#.)"-)"-)"-)[tjqqppponnmmllkk~j~j}i}i}h|h|g|g{f{fzezdydydycxbxbwawav`v`v_u_u^t^t]s]s\r]r\r[q[qZpZpY~pY~oX}oX}nW}nW}mV}mV|lU|lT|lT{lS{kSzkRzjRzjQyiQyiPxhKtdAl[7eS0_M0_M0_M0_M0_M0`M0`M0`M0`M0`M0`M0`M0`M0`M0`M(P@!!!!!T[WSZVfliTScccabb+&#.*#.*#.*#.*\vltsrrrqppooonnmmllkkjj~i}i}h}g|g|f{f{ezezdydycycxbxbwawav`v`v_u_u_u^t]s]s\s\r\r[qZqZqYpYpX~oX~oW~nW}nV}mV|mU|lU|lT{lS{kSzkSzjRzjRyiQyiNwgDp^;hV3bP0`M1`M1`M1`M1`M1`M1`M1`M1`M1`M1`M(QA"""""U\XT[WgmjTSbbb`aa+'$/+$/+$/+$/*bt}}||{{zzyyyxxwwvvuuttssrrqqppoonnmmlllkkjjiihhgggfeeedcccbba~a~`~`}_}_|^|^|]|]{\{\{[z[zVvOpGj@{d=ya=ya=ya=ya=ya=ya=ya0`M"""""V]YU\XhnkTSbbb`a`,'$/+$/+$/+$/+dv~~}}||{{{zzyyxxwwvvuuttssrrrqppoonnmmmlkkkjjiihhggffeeeddccbbaa``~_~_~^}^}]}]}\|\|\{[{WxPrIlB~g={c={c={c0aN#####~W^[V]ZiolTSaaa_`_ -(%0,%0,%0,%0,dv~}}}|{{z{zyyyxwwwvvutttsrrrqppooonmmmlkkkjjiihhggffeeddccb~b~a~a}`}`}_|_|_|^{]{]z]z\z[y[y[xZxZxYwYwXvWuQqLl8dS$####~X_\W^[jpmTS```^__!-)&1-&1-%1,%0,c}s||{{zyyxxwwvvuuttssrrqqppoonnmmllkkjjihhg~g}g}g}f|f|e{e{d{dzcycybybxaxaw`w_w_w^v^v]v]u\t\t[t[sZsZrYrYrXqXqWpWpVoVoUoUnTnT~mS~mS}lR}lCgX)#)"(!' &~Y`]X_\kqnTS```]^^!.)&1-&1-&1-&1-d~t~}}||{{zzzyyxxwwvuuuttsrrqqppponnmmllkkjjiihhh~g~f}f}f|e|e|d{c{czczbyayay`x`x_w_w^w^v]v]u\u\u[u[tZtZsYsYrYrXrXqWqWpVpVpUoTnDhZ*$*$)$)#)#~Zb^Ya]lsoTS```]^^"/*'2.&2.&1-&1-h{~~}}||{{zzyyxxwwvvuuttssrrqqqqpooonmmmllkkjjjihhhgfffedddccbbaa~`~_~_}_}^|]|]|Jrc*$*$*$*$*$}[c_Zb^mtpTS```]^^#0+'3.'2.'2.'2.k~}}}||{{zzzyxxxwvvvuuttssrrrqqppoonnmmllkkjjiiihhgggffeeddccNyh+%+%+%+$*$}\d`[c_nuqTS```]^^#0+(3/(3/(3/(3/m~~}}||{{zzyyxxxxwwvvuuttssrrrqqppoonnmmllkkjjiiihhggffeeOzj,&,&+%+%+$|]ea\d`ovrTS```]^^$1,(3/(3/(3/(3/jz~~}}||{{zzyyxxwwvvuuttssrrqqqppoonnmmllkkjjiihhggf~f~e~e}d}d}c|c|b|b{a{az`z`z_y_x^x^x]w]wKpa-&,&,&,&+%|^fb]eapwsTS```]^^%1-)40)40)40)40l|~~}}|{{{zzyyxwwvvvuuttsrrqqppooonmmllkkjjiihhggffee~d~d~c}c}b|b|a|a{`{`z_z_y^yLqc-'-'-&-&,%{_gc^fbqxtTS```]^^&2-*51*51)50)50o~}}}||{{zzyyxxxwwvvuuttssrrqqqpooonmmllkkjjjihhggffeeddPwh.(.(-'-',&{`hd_gcryuTS```]^^&3.*51*51*51*51t~~}}||{{zzyyxxxwwvvuuttsssrrqqqppoonnVq.(.(.(.(-'{aie`hdszwTS```]^^'3/+62+62+61+51u~~~}|||{{zzyyxxwwvvvuuttssrrqqqppXs/)/)/)/).'zbjfaiet{xTS```]^^'4/+62+62+62+62FWQRf_Qf^Qf^Qf^Qf^Qf]Pe]Pe]Oe]Oe]Oe]Oe]Oe\Ne\Ne\Nd\Nd[Md[Md[Ld[Ld[Ld[LcZLcZLcZKbZKbZKbZJbYJbYJbYJbYJbYJbYIbXIaXHaXHaWHaWHaWHaWG`WG`WG`WG`WF`VF`VF`VF`VE_UE_UE_UD_UD_UD_UD_UD_UD_UD^TC^TC^TC^SB]SB]SB]SA]SA]SA]RA]RA]R@]R@]R@\R@]R?\Q?\Q?\Q?\Q?[P>[P>[P=[P=[O=[O4ND /* /)/)/).(zckgbjfu|yTS```]^^(40,73,73,73,73+72+62+62+62+62+62+62+62*61*61*61*51*51*51*51*51*51)51)51)51)50)50(50(50(50(50(50(40(4/(4/(4/'4/'4/'4/'4/'4/'4/'4/&4/&4/&3/&3.&3.&3.&3.&3.%3.%3.%3.%3.%3-%3-%3-$3-$2-$2-$2-$2-$2-$2-$2-$2,#2,#2,#1,#1,#1,#1,"1,"1,"1+"1+"1+"1+"1+"1+"1+!1+!1+!0+!0+!0*!0* 0* 0* 0* 0* 0* 0* /*.(ydlhckgv}zTS```^_^)50-73-73,73,73,73,73,73,73+73+72+72+62+62+62+62+62+62*61*61*61*61*61*51*51)51)51)51)51)51)50(50(50(50(50(50(50(40(4/(4/'4/'4/'4/'4/'4/'4/&4/&4/&3/&3/&3.&3.&3.&3.&3.%3.%3.%3.%3-%3-%3-$3-$2-$2-$2-$2-$2-$2-$2-$2,#2,#2,#2,#1,#1,#1,"1,"1,"1,"1+"1+"1+"1+"1+"1+!1+!1+!0+!0+!0*!0*!0* 0* 0* 0*.'{emidlhw~{TS``````4A<-84-73-73-73-73,73,73,73,73,73,73+73+72+72+72+62+62+62+62+62+62*61*61*61*61*61*51)51)51)51)51)51)50(50(50(50(50(50(50(50(4/(4/'4/'4/'4/'4/'4/'4/'4/&4/&3/&3/&3.&3.&3.&3.&3.%3.%3.%3.%3-%3-%3-%3-$2-$2-$2-$2-$2-$2-$2-$2-$2,#2,#2,#1,#1,#1,"1,"1,"1,"1+"1+"1+"1+"1+"1+!1+!1+!0+!0+!0+!0*!0*#:1fnjemix~{TR``````PWT+83-84-84-84-73-73-73-73,73,73,73,73,73,73,73+73+72+72+62+62+62+62+62+62*61*61*61*61*61*51)51)51)51)51)51)50(50(50(50(50(50(50(50(40(4/'4/'4/'4/'4/'4/'4/'4/&4/&4/&3/&3.&3.&3.&3.&3.%3.%3.%3.%3.%3-%3-%3-$3-$2-$2-$2-$2-$2-$2-$2-$2,#2,#2,#1,#1,#1,#1,"1,"1,"1+"1+"1+"1+"1+"1+"1+!1+!0+!1+\ohgokfnjx|S@tuu``````QXU;D@;ID?MH?MH?MH?MG?MG?LG>LG>LG>LF=LF=LF=LF=KF=KF=KFbt|xs{wr{wz~cUzu}zt}yt|y{V2Лx}w|w|v~{u~zЄ2\ݛ~~}}|{{zzy~y~x}x}~]2ӛ훤~~}||{{z2???j =rC0bxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)dhwͫww2ww)w./wH2|xX-office-spreadsheetorsproxyputsypdpdhlXwJ)dh./ Da(` .20/21/43031.10-0/,/.,30)83577455343343343343343343343454677*85+40,/.-0..10031043.21.21-2//31-1/-42021,0.,85 333 ... *2+077333///,.,*2-)53344222111000000/////////000000111222344+53*3.,.,///222266)4,--- 222 276 ,0- 021254-1//21-20.20/21142.1/353 +/, 075///+3-122.0.,60122///,50.33000/// -4-!,32"/22#111$000%/1/%.2.%.3.&-2-&-2-&-2-&.3.&.2.%.1.%000%111$022#+33"-4/!.1. 000/22,40.0.111,52-0-122,50...064*0/ 343 .3/132032.10.20-4//20144-4/ 021,11/10,2.022-1./21/0/-41!/00#.3/%.22'010(.4/*-22,010-/4/.-200-1110102/2/3/3/4.3/5.215-225-226-226-226-226-205.3/5/3/4/2/30102-111-210.3./010--22,-30*/1/).11'-3/%/00#,31!.2//21-2./11+2./10-22011/2/ /42 /21-42.317=:4;8374-32 -21 .41-30-20-2/.20.20.20 .20"/21%/30'.21*/2/,-20//101.303.115/3/7-219/10;/3/<.21>-00?020@/3/A.20B.11C-11D-11D-10E-20E-10E-11D-11D.11C.21C/3/B030A-10?-21>/3/=/10;-119.3/7/105-203/201-21/.2/-/21*.30'/20%.20#.11 .30.21.20.10-20-31-22 -33 /605:76<9FMIAIF9?=.52 /3/ /4/.20.11.10.1/.30.20#.10&/20(.20+/10..201.104.206/209.21<.20>.20@.10C/20E.10G/2/I.20K-10M/30N/2/P.11Q-10R-20S.30S/30S/2/S/30S.30S-20S-20R.11Q/2/P/3/N-10M.10K/3/J.10G.20E/20C.20A/20>.10<.2/:.207/204.201/20//20,/20).20&.20#.21 .1/.20/00-20030-30143 9<:AFCEJGPWSLRO8>9!4;7$698'5;8*696-5970498358765969597<597>497A596D496G486J487L486O486R486U486W486Z486\486_385a375d386f485g376j385k475m376n385o375p474q374r375r374r474q375q285p376n475m485l376j485h386f375d385b486_485]486Z486X486U486R486P486M486J496H596E497B597?597<59695966698359705;8-7:7*598'4;8$5<6HMK NTQ[a][b^(SZV|QXTOURNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQNTQNUQNTQMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPMTPNTPNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQNUQOVRPWS}U[X(U\X^eaSYUNUQOVROVROVRPWSRYURYURYURYURYURYURYURYURYURYURXURXURXTRXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQWTQWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSOVROVROVRNUQOVRPWSV]Y]d`=NUQNUQV\Xx~{fliRYUNUQNUQV\Y>_fb>PWSPWStzw`gcOVROVRV]Y?cieSYUQXTy}x}{x}{w}{w}{w}{w}{w}{w}{w}{w}{w}{w}{w}{w}{w|{w|{w|zw|zv|zv|zv|zv|zv|zv|zv|zv|zv|zv|zv|zv|zv|zv{zv{yv{yu{yu{yu{yu{yu{yu{yu{yu{yu{yu{yu{yu{yu{yu{yuzxuzxtzxtzxtzxtzxtzxtzxtzxsxvsxvx|z|sywsywsywsywu{yz~fliNUQOVRV]YW^ZSZVsyvsywrxvrxvqwurxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvqwurxvrxvqwurxvrxvqwurxvqzvnxnxqzvqwuqwujommrpswvx|z|rxvrxvrxvqwurxvrxvqwu|_fbOVRPWS_fb#U\X[b^sywrxvrxvrxvqwurxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvqwurxvrxvqwurxvrxvqwuqyvVMяNяVqyvpvtfkijnlqwurxvrxvsywsywtzxuzxrxvrxvqwurxvrxvqwurxv}RYUNUQV\Y#\c_tV]Yx}|qwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwunxe՝RږNЏnxpvtdigfkiqxuqxuqxuqxvqxuqxutzxqwuqwuqwuqwuqwuqwuqwurxvekhNUQSYVu\c`Za]X_[rxvqwurxvrxvrxvqwurxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvqwurxvrxvqwurxvrxvqwunxNЏnxpvtdigchfrwvrxuqwuqxvrxuqwutzxrxvrxvqwurxvrxvqwurxvrxvz~x}{NUQPWSU\X^ea Za]Y`]rxvrxvrxvrxvrxvqwurxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvrxvqwurxvqwurxvrxvqwurxvrxvqwuqyvèh՟WqyvpvtdigchfpvtpvtqwuqwurxvrxvsywrxvrxvqwurxvrxvqwurxvrxvtzxOVROVRV\Y `gd[b^]d`tzxsywsxwrxvrxvqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqwuqyvo~wo~wqyvqwuqwuejhbgechfdighmkmrpqvuv{y|~~rxvqwuqwuqwuqwuqwuqwuqwuqwurxvSZVNUQW^Zcjf\c`_fcv|zu{yu{ytzxsywsywsywuzxuzxuzxuzxuzyu{yuzyu{yu{yu{yu{yv{yu{yv{yv{yv{yv{yv{zv{zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zv|zv{yv|zqvtgljfkifkigljlpopustywz~|z~}v{yv{zsywqwurxvrxvqwurxvrxvqwuT[WOVRY_\eli^eaahdx~|x~|w}{v|zx}|x}|rxvqwurxvrxvqwuT[WOVRY`]gnj_fbbie{~z~z}z~y~|qwuqwuqwuqwuT[WNUQZ`]hol`hddkg}}|jkk                                                                    nqorxvrxvrxvqwuT[WOVRZa]jqmbieelh~                                                                      v{zrxvrxvqwuT[WOVRZa]krncjffmi                                                                        z}qwuqwuqwuT[WNUQZa]lspdlhhok                                                                        z}rxvrxvqwuT[WOVR[a^ntqfmjipm    !##############################################################"    z}rxvrxvqwuT[WOVR[b^ovrgnkjqn    "$$$$$$$$$$$$$$$$$$$$'!A("B)"C)"C)"B)"C)"C)"B)"C)"C*"B*"C*"C*"B*#C*#C*#B*#C*#B*#C*#C*#B*#C*#C*-!%%%%%%&&&&&&&&&&$    z}qwuqwuqwuT[XNUQ[a^pwthpllsp    %'((((((((((((((((())-!,U3\ajojojojojojojojokokokokokokokokokokokokogk4_;8&* *!*!*!*!*!*!+!+!+!+!+!+!+!+!+!)     z}rxvrxvqwuT[XOVR[b^qxujqnmtq    '* * * * * * * * * * * * +!+!+!+!+!+!+!+!/#-V5в?iF:(,",",",",#-#-#-#-#-#-#-#-#-#-#-#+!    z}rxvrxvqwuU[XOVR[b^szwkroovr    &(( ( (( ( () ) )) ) ) ) ) ) ) ) ) ) .",U4б=hE8'+!+!*!+!+!+!+!+!+!+!+!+!+!+!+!+!)     z}rxvrxvqwuU[XOVR\b_t{xltppwt    (+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!+!0#,W5в?iF:(,",",",",#-#-#-#-#-#-#-#-#-#-#-#+!    z}qwuqwuqwuU\XNUQ\b_u}ynurqxu    -$0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&5(/[8|2W<:+3(3(3'3(3(3(3(3(3(4(4(3(4(4(3(4(1&    z}rxvrxvqwuU\XOVR\b_w~{ovsszw~~~   0%3(3(3(3(3(3(3(3(3(3(3(3(4(4(4(4(4(4(4(4)7*-W8.Y9.Y9.Y9.Y9.Y9.Y9.Y9.Y9.Y9.Z9.Z9.Z9.Z9.Z9.Z9.Z9.Z9.Z9.Z9.Z9.Z9-X98+5*5*5*5*5*5*6*6*6*6*6*6*6*6*6*6*6*3(     z}rxvrxvqwuU\XOVR\c_x|pxtt{x}}}   ,#.$.$.$.$.$.$.$/$/$/$/$/$/%/%/%/%/%/%/%/%/%/%/%0%0%0%0%0%0%0%0%0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&1&/%    z}qwuqwuqwuU\XNUQ\c_y}rzvv}z|}|   /%1&1'1'1&1'1'1&1'1'1&1'1'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'2'3(3(2'3(3(2'3(3'3(3(3'3(3(3(3(3(3(3(3(3(4(4(3(4(4(4(4(4(4(4(1&     z}rxvrxvqwuU\XOVR]c`{s{ww{{|{   5*8,8,8,8,9-9-8,9,9,9,9,9,9-9-9-9-9-9-9-9-9-9-9-:-:-:-:-:-:-:-:-:.:.:.:.:.:.:.:.;.;.;.;.;.;.;.;.;.;.;.;/;/;/;/;/01^=*Q7"@0;.;.;.;.1>1>1>1 >1 >1 >1 >1 >1 >1 >1;.    z}qwuqwuqwuU\XNUQ]c`}v~zz~yzy    3(6*6*6*6*:,0^;@nJ2a=)Q5 ?.7*7*7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8,8,8,8-8-8-8-9-9-9-9-9-9-9-6+    z}rxvrxvqwuU\YOVR]d`w{{~~~xyy    4)7+7+7+7+;-0_<˫ĤYb2b=+U7"B08,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,9,9-9-9,9-9-9,9-9,9-9-9,9-9-9,9-9-9,9-9-9-9-9-9-:-:-9-:-:-9-:-7+    z~rxvrxvqwuV\YOVR]d`x}}}}}wxx     >1"A4"A4"A4"A4#E55gBѲַkt=pJ2bA)P:#D5"B5"B5"B5"B5"B5"B5"B5"B5"C5"C5"C5"C5"C5"C5"C5"C5#C6#C6#C6#C6#C6#C6#C6#C6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D7#D7#D7#D7#E7#E7#E7#E7#E7#E7#E7!B4    |sywrxvrxvV\YNUQ^daz~~|}}vww    !?2"C5#C5#C5"C5$F65hCѲܽzBvO4fC,U<%G7#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E7$E7$E7#E7$E7$E7#E7$E7#E7$E7$E7#E7$E7$E7#E7$E7$E7#E7$E7$F7#F8$F8$F8#F8$F8$F8$F8$F8$F8$F8$F8"C5    ~u{yu{ytzxV]YOVR^da{耇|||uvv    9.<0<0<0<0!@13c?бCtN2b?*S9!A2=0=0=0=0>0>0>0>0>0>0>0>0>1>1>1>1>1>1>1>1>1?1?1?1?1?1?1?1?1?1?1?2?2?2?2?2 @2 @2 @2 @2 @2 @2 @2=0    x~|w}{v|zV]YOVR_ea|聈{{{tuu0K@1MA.J>*G;'D7%E65fBѱS]5hB-W;$G5 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!@3!A3!A3!A3!A3!A3!A3!A3!A3!A3!A3!A3!A3>1   z~y}y~|V]YNUQ_eb~肊z{{ttt"=[O@_S?_R?^Q>^Q>`PK{Yͯʪ^j'N>'N>'N>'N>'N>(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@(P@&L<   ~}W^ZOVR`fc腌yyyrrr$ ?YNB]RA]Q@\Q?[P>[O>[OA`PEjSIrVLyXP~\mvֺx#F7#F7#F7#F7#F7$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9$G9"D6   X^ZOVRagd舏xxxpqp '"Ji\MnaLn`Lm_Km_Jl^Jl^Ik]Hk\Gj\Gj[FiZEiZEhZFl[Ju]QaRbScguʫ`m3dH*SB*SB*SB*SB*SB+SC+SC+SC+SC+SC+SC+SC+SC+TC+TC+TC+TC+TC+TC+TC+TC+TC+TC+TC+TD+TD+TD+TD+TD+UD+UD+UD+UD+UD+UD+UD(Q@   X^[OVRagd艑wwwopo!!)$Mm`PrdPrdOqcNqcNpbMoaLoaLo`Kn_Jm_Jn^Lt`P|bTeWghuѴan4fI+UD+UD+UD+UD+UD,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,VE,WE,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF*SB   X_[NUQbhe苒vvvnoo"")$Kg[Nk_Mk_Lj^Ki]Ki]Jh\Jh\Jk\Nr^RzaVc]jq|Wd/]C%K<%K<%K<%K<%K<&K<&K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L=&L=&L=&L=&L=&L=&L=&L=&L=&L=%I: X_[OVRbhe茔uvvmnn ##+&Mi^PnbOmaOmaNl`Nl`SxcXf[hbn˯\iN}]dT0XG*TC+TC+TC*TC+TC*TC+TC+TC*TC+TC+TC*TC+TC+TC*TC+TC+TC*UD+UD+UD*UD+UD+UD*UD+UD+UD*UD+UD)QA#Z`\OVRdkg蒚rrrhii% (#'#$1,`ue{e{dzcyczm~rgyav\t[rZrYqYqXpWpWoVoUnU~mT~mS}lR}lR|kQ|kQ{jP{jNyhBp^6gT3eQ3eQ3eQ3eQ3fQ3fQ3eQ3fQ3fQ3eQ3fQ3fQ3eQ3fQ3fR3fR3fR3fR3fR3gR3gR3fR3gR3gR3fR3gR1aN%Z`]OVRekh蓜qqqghh&!($($%2-dyihg~g~g}qqk}e{`x_x_w^v]v]u\u[u[tZsYsYrXrWqWqVpUoUoUoTnSnSmP|jDta7jV5iT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU5jU2dP%Za]NUQelh蕝pppfgg'"*%)%&3.`~rewdwcvbucum|èlzhwas]~p\}p\}o[|oZ|nZ{mY{mXzlXzlWykVxkUxjUxiTwiSwhRvhRugQufQtfPteOseOrdNrdMqcMqcLpbJn`=dT1[J,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WF,WG,WG,WF,XG,XG,XF,XG,XG,XF,XG*UD%Za]OVRfli薞oooeff(# *&*&'4/dvi{h{gzfygyqpk|exbvbuau`t_t_s^r]r]q\~q[~pZ}oZ}oY|nX|nX{mW{lVzlVzkUyjTyjTxiSxiSxhRwhQvgQvgPufOueNteLscCkZ5`N/[I.[H.[H.[H.[H.[H.[H.[H.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I,XF&[b^OVRgmj藟nnndee($ +' +'(51lqqpoornmllkjjihggfe~e~d}d}c|b|b{a{`z_z_y^x]x]w\w\v[vZuZuYtXtXsWsVrOlCwb9pZ7nX7nX7nX7nX7nX7nX7nY7nY7nY7nY7oY7oY7oY7oY7oY7oY7oY4iT( ]c_PWShnk虡mmmcdd*%!,(!,()71ntssrqqpoonmmlkkjjihggfeed~c~c}b}a|a{`{`{`z_z^y^y]x\x[w[vZvZuYuXtWsMkBwb:q[8pZ8pZ8pZ8p[8p[8p[8p[8q[8q[8q[8q[8q[8q[8q[5kV(    ^eaQXTiol蚢lllccc*&"-)"-(*72k}pponmmllkk~j~i}h}h|g|f{fzezdydycxbwawav`v_u_t^t]s]s\r\r[qZqZpY~pX~oW}oW}nV}mU}mU|lT|lS{kS{jRzjQyiMwfEp_;hV3bP0`N0`M0`M0`M0aM0aM0aM0aM0aM0aM0aM.]J) !!!_fbSZVkqm蛣kkkbbb+'#.)".)+93msrqqponnmllkjj~i~i}h|g|f{f{ezdzcycybxbwaw`v_u_u^t^t]s\s\r[qZqZpYpXoX~nW~nV}mU}mU|lT{lS{kSzkRzjQyiOwgGra=jY5dQ0`M0`M0`M0`M0`M0`M0`M0`M.\J)!!!!ahdT[Wlro蜤jjjaaa ,'$/+#.*,:5w}}|{zzyyxwwvuuttsrrqpponnmllkkjjihhgffeddcbba`~`~_}_}^|]|]|\{[{XxQrIlC~g>zc=ya9~~}||{zzyyxwwvuuttssrqqpponnmmlkkjiihggfeedccbaa[z"6.*$*$*$hol[b^szv蟧hhh^^^$0,'2.'2.1?:~}}|{{zzyxxwwvvuttsrrqppoonmmlkkjiiihggfee_#7/+%+%+$jpm\c_u{x蟧hhh^^^%1-(3/(3/2?:~~}}|{zzyxxwvvuttsrrqqpoonmmlkkjiihgff~e~e}d}c|c|b{a{az`z_y_x^x]wXq$70,&,&,%krn]eav|y蟧hhh^^^&2.)40)403@;~}||{zzyxxwwvuutsrrqqponnmmlkkjihhggfeddc~b~b}a|`|[v%81-'-',&lsp_fbx~{蟧hhh^^^'3.*40*404A=~}}|{{zyyxxwvvuutssrqqpponnmlf&:2.'.'-'nuq`gcy|蟧hhh^^^(4/+62*514B=~~}}|||{zzyyxwwvvuutssrqqppoonmmllkke':3/)/).(ovsaiez~蟧hhh^^^)50+62+62,734A<4B=4B=4B=4A<4A<3A<3A<3A<3A;2A;2A;2@;2@;2@;1@:1@:1@:1@:0@:0?:0?90?90?9/?9/?9/?9/?9.?9.>8.>8.>8.>8.>8->8->7->7->7,=7,=7,=6,=7,=7,=6,=6+=6+=6*<5*<5*<5*<5)<5);5)<4);4);4);4(;4(;4(;4(:3':3':3&92 1* /)/).(~pxtcjf|蟧hhh^_^*51,62,62,62+62+62+62+62+62*61*61*51*51*51*51)50)50)50)50)40)40(40(40(40(4/'4/'4/'4/'4/'4/'3.'3.&3.&3.&3.&3.&3.%3.%2.%2-%2-%2-%2-$2-$2-$2,$2,$2,#1,#1,#1,#1,#1,#1,"1+"1+"0+"0+"0+!0+!0+!0*!0*!0*!0*!0* 0* /* /* /) /).(ryvdkh}蟧ppp```6A=-73,73-73,73,62,73,73+62+73+72+62+62+62*61+62*61*51*61*61*51)50)51)51(40(50(50(40(50(50'4/(4/'4/'3/'4/'4/&3.&4/&3/&3.&3.&3.%2.%3.%2-%3.%3-$2-$3-$2-$2,$2-$2-#1,$2,#2,#1,#1,#1,"1+"1,"1+"0+"1+"1+!0*!1+!0+!0*!0*!0*)>6szwemi}䞦```SXV3>:0;71=91=81<81<81<80<80<70<70<70<7/<7/;7/;7/;6/;6/;6/;6.;6.;6.:5.:5.:5-:5-:5-:5-:5-:5,:5,:5,:5,:4,94,94,94+94+94+94+94+94+94*83*83*83*83*83*83*83*82)82)82)82)82)72)72)72)72(72(71(71(71(71'71'71'71'71'71'700@:lwsryvgnk| ԛqqq___^^^Y^\\`^\`^\`^\`^\`^[`^[`^[`^[`^[_^[_^[_^[`^\`_\a_]a`]b`^b`^ca_cb_db`dc`ecaedafdbfebgecgfchfdigdigejhfjifkigkjgljhlkhmkinlinljomjomkpnkpnlqomrpmrpnsqnsqotrotrpuspusqvtrvurwuswvsxvtywtywuzxu{yv{yw|zw|zx}{y~|jroholz} qrrhhhhhhhhhghhhhhhhhghhhhhhhhghhhhhhhhghhhhhhhhiiiiiijjjjkkkkklllmmmmmmnnnnonooopppqqqqqqrrrrsrsssttttutuuuvvvvvvwwwxxxxxxyyyyzzzzz{{{{{{|||}}}}~~~~~jrnnvrz~rksoszws v}zmuq owsv}zؚqyuqxuل8s{wrzv8/ܛx}u}zt|y܄0y~x|w|z$pښ󚣠~}}|{z{p$?? r&0cxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)dhwͫww2ww)w./wH2|xX-office-spreadsheetorsproxyputsypdpdhlXw(P g-10-20,52244233232232222222232233244,52.20-20.20-31/21,2/044.00+1, 177 232 ...+/+)51165444222111111111111111222444065)40+.+...233 076 ,1- /10254-1//21/31.20.20142.2/121 ,40 011+2-122,2-/43///,4//33000.1.,41 .22"111#000#/1/$.2.$.2.%-2-%.2.%.2.$.1.$000#111".22",41 .2.000.33,3.000/44,1-122,3/122+31 132 .20132.20.31-4//21.40 /31-11/10-3//10.30/0/-31"/10$-30'/11).3/+-22-020/.3/1,2220103/2/5/3/5.206-217-227-117-227-217.206.3/6/2/50103,222.3.1010/-22-.3/+/11)-30'/00$-30"/10-30/00,2//10-11122.40 /21-42.31<275.31 .11.31-20-2/-20.20 .20#.20&/20).20-.1/0.203/205.208/2/:.21=/20?.20A-11C/20E/2/F.11G-11H-20I-10I.20I-20I-20I-11H.11G/2/F/20E-11C/30A/10?.21=/2/:.208/2/5.203.100.30,/20).20&.21#.20 .21/10-2/.31.11.41 1739=;;A>MTPGNJ4=9041 .30/2/.20.11.10.20".21&.20*/20-.201.205.208.20'>' >' >' >' >' >' >' >' >' >( >( >( >( >( =( >( >( >(;&%%%%%%%%%&&&&&   qxuqxuqxu}NUQX^[TovsShpl   (((((())))) ) ) ) ) ) ) :'FoL|||||||}}}}}}}}}}rv,T3,!+!+!+!+!+"+"+",",",",",",""   qxuqxuqxu}NUQX_[TqxuSjqn    * * * * * * * * * * *!*!*!*!*!*!*!;(bh,U4-",",",",",#,#,#,#,#,#,#,#,##   qxuqxuqxu~NUQX_[TryvSkso    ) ) ) ) ) ) * * * * * * * * * * *!;(bg+U4,"+!+!+!+"+"+"+",",",",",","#   qxuqxuqxuNUQX_[Tt{xSmtq   $.$.$.$.$.$.$/$/$/$/$/$/%/%/%/%/%/%!?,Y`׹׹׹׹׹׹׹׹׹׹׹׹׹׹׹׹׹ŧ*Q41&1&1&1&1&1'1'1'1'1'1'1'1'1''   qxuqxuqxuNUQY_\Tu}ySovs   '2'2'2'2'2'2'3'3'3'3'3(3(3(3(3(3(3("A./[:1\;1];1];1];1];1];1];1]<1]<1]<1]<1]<1]<1]<1]<1]<1]<.X:5*5)5)5)5)5*5*5*5*6*6*6*6*6*6**!   qxuqxuqxuNUQY_\Tw~{Spxt~~~   %/%/%/%/%/%/%0%0%0%0%0%0%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1'1'1'2'2'2'2'2'2'(   qxuqxuqxuNUQY`\Ty}Srzv}}}   ( 3(3(3(3(3(3(4(4(4(4(4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)4)5)5)5)5)5)5)5)5)5)5)5*5*5*5*5*5*6*6*6*6*6*6*6*6*6*6*+!    qxuqxuqxuNUQY`\Tz~Ss{x{|{   -#:.:.:.:.&H4"A1;.;.;.;.;.;/;/;/;/;/;/;/;/;/1 >1 >1 >1 >1 >10&   qxuqxuqxuNUQY`\T|Su}yzzz   ,"7+7+7+7+,T73b>,U8"B08,8+8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,8,9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-9-:.:.:.:.:.:.:.:.:.:..%   qxuqxuqxuNUQY`\T}Sw{yyy   ,"7+7+7+7++T7DrM-X9#E18,7,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8,8,8,8,8,9,9,9,9,9,9,9,9,9,9-9-9-9-9-9-9-9-9-9-.$   rxvqxuqxuNUQY`\TSx}xxx   3("B4"B4"B4"B40]>U_5fC*S;#E6"C5"C5"C5"C5"C5"C5"C5"D5"D5"D5"D5"D5"D5#D6#D6#D6#D6#D6#D6#D6#E6#E6#E6#E6#E6#E6#E6#E6#E6#E7#E7#E7#E7#F7#F7#F7#F7#F7#F76+   tzxsywrxvNUQZ`]TSz~vww   3(!A3!A3!A3!A3/\>ͬak8iE,V<$G6"B4"B4"B4"B4"B4"B4"B4"B4"B4"B4"B4"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"C5"D6"D6"D6"D6#D6#D6#D6#D6#D6#D66*   w|zv|zu{yNUQZa]TS{uvv5,$A5"@3 >1=0-Y;նnv:jF,V:#D3=1=1>1>1>1>1>1>1>1 >1 >1 >1 >1 >1 >1 >1?1 ?1 ?1 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?23(   y}x~|x}{NUQZa]TS}tut1H>>\P=[N;YL8WJ@lOŦ~BuP1aB)P<$G9$G9$G9$G9$G9$G9$G9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H9%H:%H:%H:%H:%H:%H:%I:%I:%I:%I:%I:%I:%I:%I:%I:%I:9.   |{{~NUQ[a^TSstt4NCDdVCcVBcUAbTKv[Zg~ƨKZ6jH-YB'N>'N>'N>'N>'N>(N>(N>(N>(N>(N>(N>(N>(O>(O>(O>(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?(P?>1   ~}NUQ[b^TSrsr4KBB^RA]Q@\Q?[P>[O@_PDhSHqVLyX^iˮGyT*S;"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D7"D7"D7#E7#E7#E7#E7#E7#E78,   NUQ\b_TSqqq8PFHfYGeXFdWEcWDcVCbUCaTBaSBaSDgUHoXKxZQ_kvԶpz-Y@%J;%J;%J;%J;&J;&J;&J;&J;&J;&J;&J;&J;&J;&J;&J<&J<&J<&J<&J<&J<&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<<0   NUQ\c_TSppp  >XMPqdOqcNpbMoaLo`Kn`Jn_Im^Im]Hl]Io]Lv_QbWfkxs~2dI+VD+VD+VD+VD,VE,VE,VE,VE,VE,VE,VE,WE,WE,WE,WE,WE,WE,WE,WE,WE,WF,WF,WF,WF,XF,XF,XF,XF,XF,XF"D6   NUQ]c_TSooo!!>VLOmaMm`Ml_Lk_Kk^Jj]Jj\Lo^Px`Tc\j{ƨmx/]C'N>'N>'N>'N>(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?(P? @3   NUQ]c`TSnnn #"?WNPnbOmaNl`Mk_PraU}dYggsҷҶt~P^8_K'L=&K<&K<&K<&K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L=&L='M='M='M='M='M='M=>2   NUQ]d`TSmmm!$ $ FbWZ~pZ}oY}nX|m`r̯o~XjP~fJsbIraFo^9eS0^K/^K0^K0^K0^K0^K0^K0^K0^K0_K0_K0_K0_L0_L0_L0_L0_L0_L0_L0_L0_L0_L0`L0`L0`L0`L0`L0`L%J;NUQ^daTSklk#%!%!HbX\~p[}oZ}oY|nbsҷ¥kyYkR|gMsdLrcKqbJqbIpaIp`Ck[5`O.[I.ZI.ZI.ZI.ZI.ZI.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.[I.\I.\I.\I.\I.\I.\I$H:NUQ^eaTSjkj$&"&"G`V[ymZxlYxkXwkapзgtYiQvdMoaLn`Km`Kl_Jl^Ik]Hj\Gj\Fi[EhZOVRagcTSdee*%!,'!,'Zwlssrqqoonmllkjihggfedd~c}b}a|`{`{_z_z^y]x\x[w[wZvYuXtQoFzf{c=zb=zb/_L"""U]YgnjTS```".)%0,$0+bt~}}|{zzyxwvvuttsrqponnmllkjiihgfeedcbb~a}`|_|^{^{]z\y[y[xZxYwWuQpKl7bQ$##W^[iolTS___#/*&1-%0,b{r}|{zyxxwvuttsrqpponmlkkjihh~g}f}e|e{d{czbyay`x`x_w^v]u\u[t[tZsYrXrXqWpVpUoTnT~mBeW)#("(!Y`]kqnTS^_^$0+&2-&1-gy~~}|{zzyxwwvutssrqqpoonmlkkjihhgfeddcbaa~`~_}^}]|Iqa*$*$*#Zb^lspTS^_^%1,'2.'2.k~~}}|{{zyxwwvvutsrrqpponmllkjiihggfedMxh+%+%+$\d`nuqTS^_^&2-(3/(3/iy~}}|{zyxxwvuttsrrqponnmlkjjihgfe~e~d}c|b|b{az`z_y^x]xJn_,&,&,%^eapvsTS^_^'3.)40)40m~~~}|{zzyxxwvuutsrqpponmmlkjiihgfeedNuf-'-'-&_gcqxtTS^_^(4/*51*51s~~}|{{zyxxwvuutssrqppoVp.(.(.'aieszvTS^__)50+62+62EVPPe]Pe]Od\Od\Nc[Nc[Nc[Nc[Mc[McZLcZLbZKbYKbYKaYJaYJaXIaXIaXHaWHaWH`WG`WG`VG_VF_VF_UF_UE^UE^UD^TD^TC^SC]SC]SC]SB]SB]RA\RA\R@\Q@[Q@[Q?[P?[P?[P>[P>ZP=ZO=ZO=ZNGC=ID>JE>JE>IE>IE>ID=ID=ID=HD-11=.20;/209-217/2/4.211/20/-20,/20)/30%.20".10.20.21.10-21.32 -32061496ELH9@=163 .4//20.11.10.20.21#.20(.20+.10/.203.207.20:.20>/20A.10D.20G.20J.20M-10O/2/Q.11S-20T.20U/2/V/2/V/20V.20U-20T.10S/2/Q-10O/20M.20J.20G.20D/20A.20>.10:.206.203/10//20+.20'/20#.20.10.11/30/30264 ;A=FLHX_[U\X;RYUlLROCIFDIFCIFCIECIECIECHECHEBHEBHEBHEBHEBGDBGDBGDAGDAGDAGDAGDAGCAGDAGCAFC@GCAFCAFCAFDAFCAFCAGCAFCAGCAFDAGDAGCAGDAGDAGDBGDBGDBGDBGDBHDBHEBHECHECHECIECIECIFCIGDIFCIFLROnPWS=SZV \b_W^ZePWSOVROVRPWSQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQWTQWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSOVROVROVROVRSZVeV\Y^eaT[WOVRpvsv{y^daOVRQXTV]Z_ebV]YSZV~qwtPWSQXTV]Y]c`cSZVv|zrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvqwupzvo~xpzvqwuntrmrptyw{}rxvrxvqwurxvrxv}qvtOVRSZVc_ebV]YqwtrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzvSŌNӑRŌqzvjpnhmkqwurxvrxvsywtzxrxvrxvrxvrxvrxv}]d`OVRV]Y]d`5W^Zy}qwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvo}wNӐo}wjomdigqxvqxuqxurxu{~sywrxvqwurxvrxvqwusxwu{xNUQT[W6]d`eY`\rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzvTÌqzvjomchfqvtqwuqwurxvy~|sywrxvrxvrxvrxvrxvrxvOVRSYVe`fc{]d`tzxsywsxwrxvrxvrxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvqwuqyvo}wqyvqwulrpbgechfejhkpnrvux}{}rxvrxvqwurxvrxvqwurxvRYUT[W{cif~_fcw}{v|zv|zu{yz}rxvrxvrxvrxvRYVU[X~elh~ahd{~z}y~|rxvrxvrxvSYVU\X~fnj~cjf~}JMK                                                    JNLqwurxvSYVU\X~hol~elh                                                       rxvrxvSZVU\X~jqm~gnj                                                      qwurxvSZVU\X~lso~hpl   "$$$$$$$$$$$$$$$%&&&&&&&&&&&&&&&&&%$$$$$$$$$$$$#   rxvrxvSZVV\Y~muq~jqn   $&&&&&&&&&&&&&&& >(1Y75]<6]<6]<6]<6]<6]<6]<6]<6]=6]=6]=6]=6]=6]=6]=4[:%G-'('(((())()('   qwurxvSZVV\Y~ovs~lsp   () ) ) ) ) * * * * *!*!*!*!*!*!#C,̭(M1,",",",",#,#,#-#-#-#-#-#+!   rxvrxvSZVV]Y~qxu~nur   ') ) ) ) ) ) ) ) ) ) ) ) ) ) ) "B+Ѳ'L0+!+!+!+!+"+"+"+"+"+"+"+"*    qwurxvSZVV]Y~szw~pwt   +"-#-#-#-#-#.#.#.#.#.$.$.$.$.$.$$F.Ƨ(M2/%/%/%/%0&0&0&0&0&0&0&0&.$   rxvrxvSZVV]Y~u|x~ryu   0&2'2'2'2'2'3'3'3'3(3(3(3(3(3(3(%H12^<5`?5`?5`?5`?5`?5`?5a?5a?5a?5a?5a?5a?5a?5a?5a?0W;6*5)5)5)5*5*5*5*6*6*6*6*6*3(   rxvrxvSZWV]Y~v~z~s{w~~~  -#/%/%/%/%/%0%0%0%0%0%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1'1'1'2'2'2'2'2'0%    qwurxvSZWV]Y~x|~u}z}}}  3(5)5)5)5)5)5)5)5)5*6*6*6*6*6*6*6*6*6*6*6*6*6*6*6+6+6+6+6+6+7+7+7+7+7+7+7+7+7+7,7,7,8,8,8,8,8,6*   rxvrxvTZWV]Z~z~~w{{{{  8,:.:.:.'K5(N6 >/;.;.;.;/;/;/;/;/;/;/;/1 >1 >1 >1 >1;/   qwurxvT[WW]Z~|~y}zzz   4)6*6*6*'L3N{W9fD(N4<,7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8-8-8-9-9-9-9-9-7+   rxvrxvT[WW]Z~}~{yyy   :.<0<0<0*Q8DsO,V:#E3=0=0=0=0=1=1=1=1=1>1=1>1>1 >1 >1 >1 >1 >1 >1 >1 ?1 >1 ?1 ?1 >1 ?1 >1 ?1 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2=0   rxvrxvT[WW^Z~~}www   !@3"C5"C5"C5-W=Q]2aA(N:#E6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#F8#F8#F8$F8$F8$F8$F8$F8"D5   u{ytzxT[WW^Z~~vvv   'L6>1=0=0>0>0>0>0>0>0>1>1>1>1>1>1?1?1?1?1?1?1?1?1?2?2?2?2 @2 @2 @2 @2 @2=0   x~|w}{T[WX^Z~~uuu:WJ;YL8VI3RE9bIԵjs9kH,V=$G8#E7#E7#E7#E7#E7#E7$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$G8$G8$G8$G8$G8#D6   |{~U[XX_[~~ttt!A`SCcVBcUAbTHpY`lϱ޿{?tO1aE)R?'N>'N>'N>'N>(N>(N>(N>(N>(N>(N>(O>(O>(O>(O?(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?&L=  ~U\XX_[~~rsr#@[PB^RA]Q@\P?[P@^PDgSHpUMyYjsԸ3eB"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D7"D7"D7#E7#E7#E7#E7#E7"C5  U\XY_\~~qqq% GeXIh[HgZGfYFfXEeXDdVCcVCdUEhVHqYLy\Ygv7lH'M='L='L='L='M='M='M='M='M='M='M='M='M='M>'M>'M>'M>'M>'M>'N>'N>'N>'N>'N>'N>'N>'N>&K<  U\XY`\~~ppp!&"Mn`OrdOqcNpbMoaLo`Kn_Jn_Im^Ks_OzaSdftҵ:sM+VD+UD+VD+VD,VE,VE,VE,VE,VE,VE,VE,WE,VE,WE,WE,VE,WE,VE,WE,WF,WF,WF,XF,XF,WF,XF,WF*TC  V\YY`\~~noo "(#Lh]Nk_Mk_Lj^Ki]Kj]Nr_R{aZgs~Ȫ;nL&L<%K<%K<%K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L=&L=&L=&L=&L=&L=%J;V]YZ`]~~mmm!#)%RqeUuhTugStfX~ihuͱȪiwPbHp];aQ.WF*TC*TC+TD+UD+TD+UD+TD+UD+UD+UD+UD+UD+UD+UD+UD+UD+UD+UE+VE+UE+VE+VE+VE+VE+VE*SB V]YZa]~~lll#$ +&Y{m\q[pZ~o`r˯gwWjPyfLudKtcJscHqa=hW1_M0^L0^L0^L0^L0^L0^L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_M0_M0_M0`M0`M0`M0`M0`M.\J V]YZa]~~jkk$&" ,'WuiZxlYxkXwj^nʰbpU~fNqbLm`Km_Jl^Ik^Hk]Gj\Fi[BfW4ZK*RB)QA)RA)QA)RA)RA)RA)RA)RB)RB)RA)RB)RA)RB)RB)RB)RB*SB*SB*SB*SB*SB(P@!W]Z[a^~~ijj%!'#!.)^~qau`t_sevγev]pV|lUzkTyjSxiRwhQwhPvgOvfNueMteLsdLscEn]6bP/\J/\J/\J/]J/]J/]J/]J/]J/]J/]J/]J/]J/]K/]K/]K/^K/^K/^K/^K/^K-ZH"W^Z[b^~~hhh&"($#0+ezh~g~f}kҷ׼k}dz_w^v]v\u\u[tZsYrXqWqVpUoTnTnSmR~lIwe;mY5hT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iU5iU5iU5jU5jU5jU5jU5jU3eQ#W^Z[b^~~ggg(#*%$1,btewdwcviyyhxas]~q]~p\}o[|oZ{nY{mXzmWylVxkUxjTwiSwhRvhQugPtfPteOseNrdMqcLqbCiZ5^N-XF,XF,XF,XF,XF,XF,XF,XF,XG,XG,XG,YG,YG,YG,YG,YG+VE$W^Z\b_~~efe)$ +&&2-i}mlkopj~g|f|f{e{dzcybxaw`w_v^u]u\t[sZrZqYpXpWoVoU~nT}mT}lS|kLwe?mZ4fR2dP2dP2dP2dP2dP2dQ2dQ2dQ3eQ3eQ3eQ3eQ3eQ1aN%Y_[]c_~~ddd*%!,('4/pssrqponmlljjihgfed~c~c}b|a|`{`z_z^y]x\x[wZvYuYuVsL~kAva9q[8pZ8pZ8p[8p[8p[8q[8q[8q[8q[8q[6lW&  [a^^ea~~ccc+'"-)(50mppnmmlkj~i}h}g|f{fzeydycxbwav`v_u^t]s\s\r[qZpYpX~oW}nV}mU}mT|lS{kSzjQzjMwfDo^:hV2aO0`M0`M0`M0`M0`M0`M0`M/]K'!!\c``gc~~abb!,(#.*)71twwvutsrrqponmlkjiihgf~e~d}d|c|b{az`y_y^x]w\w[v[uZtYtXsWrUpL|iDvc=q\8mX6lW7mW6lW4iT( "!^eabie~~`a`"-)$/++83z~}|{zzyxwvuttsrqponmmlkjiihgfeddcba`~_~^}]|\|\{YyStKnFi>wa*!""`gddjg~~___#/*%0,,94x|{zyxwvvttsrqponmlkkjih~g~f}e|e|d{czbyay`x_x^w]v\u[t[tZsYrXrWqWpUoUoTnPzi/('!&biffli~~^_^$0+&1--:5~~}||{zyxwvuutsrqpoonmlkkjihgfeddcb~a}`}_|^{]z]z\yWt 2+*$*#dkghnk~~^_^%1,'2..<7~}|{{zyxwwvutssrqponnmlkjiihgfed`!4-+%+$fmiipm~~^_^&2-(3//<7~}|{zyxxwvutsrrqponmlkkjihgfe~d~c}b|b{a{`z_y^xZs"5-,&,%hokkro~~^_^'3/)401>9~}|{zzyxwvuutsrqponnmlkjihhgb$6/-'-'iqmmtp~~^_^(40*512>:~~}|{{zyxwwvutssrqpponmmlg%70/(.(ksoovr~~^__)51+62,732?:2?:2?:2?91>91>91>90>90>90>8/=8/=8/=8/=8.=7.=7.=7.<7-<6-<6-<6,<6,<6,;6,;5,;5+;5+;5+;4*;4*:4*:4*:4):4):3):3(93(93(93'92'92'92'92'82&81&81&81%70 0*/).(mtqqxt~~___.95,73,62,73,62+72+62+62+62*61*61*51*61*51)51)50)50(50(40(50(4/(4/'4/'4/'3/'4/&4/&3.&3.%3.%3.%2-%3-%2-$3-$2-$2-$2-#1,#2,#1,#1,#1+"1,"0+"1+"1+!0+!0+!0*!0* 0* 0* 2+ovsryv~zaaaHOM/:60;70;70;70;6/:6/:6/:6.:6.:5.:5.:5.95-95-94-94-94,94,84,84,84+83+83+83+83+83*82*82*82*72)72)72)72)72)72(71(71(71(61(61'61'61'60'60'60&50&50&50&5/&5/&5/'61Tb]pwsszw{d```\^]]`^]`_]`_]`_\`^\`^\`^\_^\_^\`^]`_^a`^ba_ba`cbadcaecbfdcfedgfdhgeigfihgjihkjhljimkjmlknmkonlpomqonqpnrqosrptrqusrutsvuswutxvuxwvyxvzyw{zx|zy}{z}|{~}{~jqnryve3jroz~4ڮovs~]pxt}]v~zu}y u}yx} \כ}x}y}ׁ\6awzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzxa6??ڨ r0exiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)dhwͫww2ww)w./wH2|xX-office-spreadsheetorsproxyputsypdpdhlXwJ)dh./ (@ B.20-31.20-1/054/10,..+3/ /75 454 333 232 232 232 333 555 ,74 +1- -/.021/53.0//21021.20031/30-1.043 ,2/111,4/111,3.033/0/,3.-33111!010!.1.".1.".1.#.1."/1/"010!111 ,32-2.000.43-1-133+2.132.1/.43 021.20032.21.42-3/032 .30.11.1/.20.2//10!-31$.2/'.21*.3/-.11//3/1-214/105/3/7.3/8-219-119-119-119-209.3/8/2/7.115-203/2/1-21//2/,-21)/10&-30#/20 .1/-2/.20.11.2/ /33 .31.42DJG;B?174 /2//22-20.2/.20 /20$.20).20-.201.205.209.20<.20@.20C/20F.10H.20K/20M.11N-20O.20P/30P.20P-20O.11N/2/L.20J.20H/20E.20B.10?.20;.208.204.200.20,/20(.20#/21.1/.20.21.4/ 487>C@U[XQXTBHPK[=C@`>C@c=B?f=B?j=B?m=B?p=B?s;A>;@><@>;A><@=;@>;@=;@=;@=<@=;@=;@><@=;@>;@>;A>C@f>C@b=D@]LQNEPVS\b^&SYUOVROVRPWSQXTQXTQXTQXTQXTQXTQWTQWTQWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSOVROVROVRPWSU\X&\b_QOVRgmiuzxZ`]OVRU\XQ_fb8QXT~~||z~z~}gmjOVRU\X8]d`U\Xv|yrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzveeqzvntrlpnsxvx}{~|rxvrxvrxvrxv|`fcOVRU\X^daAV]Yrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxve~xNٔe~lrpfkiqxuqxurxurxv|rxvrxvrxvrxvrxvOVRT[WB\c`hnkrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvwye~lrpchfrxuqwurxvqwuz}rxvrxvrxvrxvrxvv|zY_\RYU^eb{~~sywrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqyvwf~qyvmsqchfgljjomotrtyw~v|zrxvrxvrxvrxvrxvrxvagdRYUahe~v|zu{ytzxw|z|}}~~~x|zuyxvzxz}|y~|rxvrxvrxvrxvcifSZVdkgz}y~|rxvrxvrxvdjgSZVfmi}~>B@                                              =B@{~rxvrxvdjgSZVhok                                                rxvrxvekhSZVjqm                                               rxvrxvekhSZVlso  %%%%%%%%%%%%%%2"9%9%9%9%9%9%9%9%9%9%9%9%9%9%9%/!%%%%%%%&&&&   rxvrxvfliSZWnuq  ((((()))) ) ) ) ) ) &J/qu#D,+!+!+!+"+"+",",",",","   rxvrxvfliTZWpws  ) ) ) ) ) * * * * *!*!*!*!*!&J/ܾĥ#D,+!+!+!,",",",",",",","   rxvrxvgmjT[Wryu  ,",",",","-"-"-"-"-#-#-#-#-#'L1ܾť$F..$.$.$.%.%.%/%/%/%/%/%  rxvrxvgmjT[Wt{w  2'2'2'2'2'3'3'3'3(3(3(3(3(3()N47cA9dC9dC9dC9dC9dC9eC9eC9eC9eC9eC9eC9eC9eC0W<6*5)5)5)5*5*5*6*6*6*6*6*  rxvrxvhnkT[Wu}y~~~  /%/%/%/%/%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&1'1'1'2'2'2'2'2'   rxvrxvhnkT[Ww|}}}   6+6+6+7+6+7+7+7+7+7+7+7+7+7,7,7,8,8,8,8,8,8,8,8,8,8,8,9,9,9-9-9-9-9-9-9-9-:-:-:-:-:-   rxvrxviolT[Wy~{{{  9-9-9-%G3.Z:%G3:-:-:-:.:.:.:.:.:.:.;.;.;.;.;.;/;/;/;/;/;/;/;/;/;/;/;/;/<0<0<0<0<0<0<0<0!  rxvrxviolT[W{zzz  7+7+7+#E1ltqx3_>%H28,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8,8,9,9,9,9,9,9,9,9-9-9-9-9-9-9-9-!  rxvrxvjpmT[W}xxx  #"B5"B5"B5)P:?pL,V=$F6#C5#C5#C6#C6#C6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E6#E6#E7#E7#E7#E7#E7#E7#E7#E7$F7$F7$F7$F7$F7%  sywsywjpmU[Xwww  " ?2 ?2 ?2'L7IxT-W;#E4 ?2 ?2 ?2 @2 @2 @2 @2 @2!@3!@3!@3!@3!@3!@3!A3!A3!A3!A3!A3!A3!A3!A4!A4!A4!B4!B4!B4!B4!B4%  w}{v|zkqnU[Xuuu/(6SG3PD/M@1WAãV`/\?&J8"B5"C5"C5"C5"C5"C5"C6"C6"C6"C6"C6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6#D6#D6#D6#D6#D6&  {~z}mspU\Xttt$5.CdVBcUAbTEkWdpػҳgs6jH-XA'N>'N>'N>'N>(N>(N>(N>(N>(N>(N>(O>(O>(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?*"  ~}ntqU\Xrsr%5.B^SA]R@]Q?\P@^PCgRGoUQ}]u~ܿ\f(P:"D6"D6"D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E7#E7#E7#E7#E7#E7#E7#E7(  ourU\Xqqq(:3Kk^Jj]Ii\Hh[GhZFgYEfXDeWFjXIr[O_]k.[C(O?(O?(O?)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)QA)QA)QA)QA)QA)QA)QA)QA,#  qvsV\Yppp!+=6PpcNobMnaMm`Km_Jl^Jm^Nu`Q~b]lͰ/^E)RB)RB)RB*SB*SB*SB*SB*SB*SB*SB*SB*SC*SC*SC*SC*SC*TC*TC*TC*TC*TC*TC*TC*TC.%rwuV]Ynnn!",=6PmaOl`Nk_Nm_SxbWenzٿZg3[G&K<&K<&K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L='M='M='M='M='M=-#syvV]Ymmm"$ 0D<[~pZ~oY}n\p`qRgKucIrbCn\5bP/^K0^L0^L0^L0^L0^L0^L0_L0_L0_L0_L0_L0_L0_L0_M0_M0_M0`M0`M0`M0`M0`M3)tzwW]Yklk$%!1D=[{nZzmYyl\nũ\lS{fMpbKoaJn`In_Hm^Gl]=dU/XH+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE,WE,WE,WE,WE,WE1'v{xW]Zjjj%!'#4F?_s_r]~qasǬڿ`pXkSvhRvgQufPteOsdNrdMrcKqbJpaIo_RJsrqponmlkjihgf~e}d|c|b{az`y_x^x]w\v[uZuYtXsWrVqQlEvc:nZ6kV6kW6kW6kW6lW6lW6lW6lW6lW;/  ~[a^bcc ,'".)?QJrqponmlkj~i}h|g|f{ezdycxbwav`u_u^t]s\r[qZpYpX~oW}nV}mU|lT{kSzjRyjLudAm\7eS1`M0`M0`M0`M0`M0`M9-!!]d`aaa!-)$/+CXP~}|{zyxwvuttrrqpnnmlkjihgfedcba`~_~^}]|\|ZzTtLnDh>{c=zb!A4""_fb_``#/*%0,DWP}|{zyxwvutsrqponmlkjiihgf~e}d}c|a{a{_z^y^x]w\v[vYuYtXsWrUqPm*F;%$ahd^__$0+&1-FYR~}|{zyxwvutsrqponmmlkjihgfed~c}b|a{`{_z^y]y\x[wZvYu1KA*$)#cjf^__%1-'2.J^W~}|{zyxwwvutsrqponmlkjihhgfed5RG+%+$elh^__&2.(3/J\U~}|{zyxvvutsrqponmlkjihgfe~d}c|b{a{`z_y^x4ND,&,%gnj^__(3/*50MaZ~~||{zyxwvutsrqpoonmlkji9UJ.'-'ipl^__)50+61DUOssrqpponnmllkji~h~h}g}f|f|e{e{dzczbybyax`x`w_w^v]v]u\u[t[tZsYsXrXrWqVp3LB/).(kro^__*51,73,72+62+62+62*61*61*51*51*51)51)50)50(50(50(4/(4/'4/'4/'4/&4/&3/&3.&3.%3.%3.%3-%3-$2-$2-$2-$2-#2,#1,#1,"1,"1+"1+"1+"1+!1+!0+!0* 0* 0* 0*/)mtq```7B>-73-73,73,73,73+72+72+62+62+62*61*61*51)51)51)50(50(50(50(4/'4/'4/'4/'4/&3/&3.&3.&3.%3.%3-%3-$2-$2-$2-$2-$2,#2,#1,#1,"1,"1+"1+"1+!1+!0+!0*0B;ovr}}}\^]MSQOVTOVSOVSOVSOVSNVSNUSNUSNUSOVSOVTOWTPWTPXUQXUQXVRYVRYWRZWS[XS[XT\YT\YU]ZU]ZV^[V^[W_\W_\X`]X`]Ya^Yb^Zb_Zb_[c`[c`\da\ea]eb]fc^fc^gc_hdbifovsrw~{u|yr"ltq}#v~z֧s|xքw|x}N⛤~}|{z~N? r0fxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2(0` %/21-1/-10/63243232222232344,42-1/.20/21/31/20.30-2/ /10/52-1.033.0.+31122010/1/.1./1/010032+2/010-41000.31/32 /21 .21/20/21285/42.30 .31.20.2/.20.20#.20'.20,/200.113.306.109/2/;.20<-11=-21=-21=.2025381533153-254'264!2759>;INKX_[.SZVOVROVRPWSPWSPWSPWSPVSPVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROUQQWTTZW.[a]ZX_[pvsSZVT[W[]c`.Za]u{yuzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtyxtywtywsywsywsywsywsywsywsywr|xr|xsywotsw|zsywrxvuzy~SZVT[W.Za]rxvqwurxvqwuqwurxvqwurxvqwuqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqzvhҞQ͏pyufkiqxvrxvsyvsywrxvqwurxvpusQXT[b^Y`]rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzviҞpyuchfqwuqwurxvsywrxvrxvrxvtzxOVRRYU^eb ]d`{tzxsywrxvsywsywsywsywsywsywsywtywtywtywtywtzxtywtywtzxtywtywtzxtywtywtzxtywtywtzxtyws{xs{xtywhmkejhjomsxv{~tzxrxvqwuqwurxvQXTSZW bie `gcy~||rxvrxvQXTT[X elh cjf}&+)                                  %*(sywrxvQXTU\X gok emi                                    v{yrxvQXTU\X jqn hol  #$$$$$$$$$%2"3"3"3"3"3"3"3"3"3"3"3"&$$$$$%%$  v{yrxvQXUU\X mtp kro  '))) ) ) ) * * * ,!Y_¤åååååååååin2$+"+",",",",","+!  v{zrxvRXUU\X ows nuq  (* ) * * * * *!*!*!,"ns2%+"+",",",",","+!  v{yrxvRYUV\Y ryv pwt  0&1'1'1'2'2'2'2'2'2'4(AkJ`g`h`g`g`h`h`h`h`h`hBfL6)4)4)4)4)5)5)5)3(   v{yrxvRYUV]Y u|y s{w  /%0%0%0%0%0%0&1&1&1&1&1&1&1&1&1&1'1'1'1'2'2'2'2'2'2'2'2'3'3'3'1'   v{zrxvRYUV]Y w{ v~z}~}  8,:-;.&H3;.:-:.;.:.:.;.:.;.;.;.;.;/;/;/;/1?1?1?1?1 ?2 ?2 ?2 ?2 ?2 @2 @2 @2 @2 @2 @3 @3 @3 @3 @3 ?2  }x~|RYUW^Z wwwA`SAaT@aSfrͰBrR,W@'M='L='L='M='M='M='M='M='M='M>'M>'M>'N>'N>'N>(N>(N>(N>'L=  }SZVX^[ uuu!B^RB_SA]Q@^QCfSHoVdoӷy'N:"E6"E6#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#F8#F8#F8#F8#F8"D6 SZVX_[ stt$ Mn`NobLn`Km_Jm^Hl]Jp]O|aerâ/]F*TC*TC+UD+UD+UD+UD+UD+UD+UD+UD+UD+VD+VE+VE+VE+VE+VE*TC SZVY_\ rrr!&!Mj^Nl`Mk^Pr`U}dur}.VC&K<&K<&K<&K<&K<&K<&L<&L<&L=&L<&L=&L=&L=&L='M='M='M=&K<SZVY`\ ppp#($Y|nZ~pY~o~TiLvdIrb@jY2`M0^K0^K0^K0^K0^K0_K0_L0_L0_L0_L0_L0_L0`L0`L0`L/]JT[WZ`] noo% *&YwkZymYylжuU}gNqbLnaKm_Il^Hk]EiZ8^O+TC*SB*SB*SB*SB*SB*SB*SB*SB*SC*TC*TC*TC*TC)RAT[WZa] lmm'"!-(ezf|e{βvbx]u[tZsYrWpVoUnS~mR~lNzh?o\4gS4gR4gR4gS4gS4gS4gS4hS4hS4hS4hS4hS3eQ!T[W[a^ kkk)$#/*dvfxew|pcu_r]q\~pZ|oY{nWzmVykUxjSwiRvhQugPteNsdIo`;dS/[I-YG-YG-YG-YG-YH-YH-ZH-ZH-ZH,XF"U[X\b^ iii*&%1,prppnlkjigfd~c}b|`{_z^y]x\wZvYuVrK}i?t_8oY7oY7oZ8oZ8pZ8pZ8pZ6mW$ W^Z]d` ggg!,(&3.oqonmkj~h}g|fzdycxaw`v_u]s]s[qZpX~oW~nU}mT|lSzjNwfCo^9gU1aN0`M0`M0`M/^L%!Za]`gc eee".)(50{}|zyxwvtsrponmkjihfedba`~_}]|[{UuMoFi>xb'"\c`cif cdd$0+*62z|{yxwutsqpomljihg~f}d|c{ay`y_w]v\u[tYsXrWqVpR}l-''!_fcfli ccc%1-,84~}{zywvutsrponmkjigfed`0*+$biehol ccc'3.-:5~}|zyxvutsqpomlkihged~c}a|`{\w!2+,&elhkrn ccc)40/;7~}|{zxwvutrqponmh#4-.(goknuq ccc*61,730<70<7/<7/;7/;6.;6.;6-:6-:5,:5,:5,:4+94+94*93*93*83)83)82(82(82(71'71'71'71&60&60%60%6/%6/$5/$5. 0*/)jqnpwt ooo:D@/:5/:5.95.95-95-94-84-84,83,83+73+73*73*72*72*72)61)61(61(61(51(50'50'50'5/&5/&4/&4/%4/%4.%4.$4.$4.$3-9ICltprxu oppaccbdcbdcadcadcadcadcbddcfedgffhggihhjiikkjmlknmmonnpooqqpsrqtssuttvuuxwvyxwzyy{zz|{{~}|~}kroqxuszw+y}+U~U+垧{+ r 0gxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5( @ 031.20.30.30 .20 022,2/132020020132-31/1/.30/21 /21/21/318?</52.31.20.20.20'.20..205.20:.20?.20B-21D.21E.20C/20@.20<.207.201.20*.20".21.20.31 597U[X4QXTIPLGMJGMIGMIFLIFLIFLIFLIFLHFLHFLHFKHFKHFLHFKHFLHFLHFLHFLIFLIFLIFLIGMIFMINUQRXU4Y`\`~fliSZV`Za]x~{󩭫rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvmbkpntywy~|rxvrxv}_fbRYU[b_I|rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvmhmkmsqrwu}rxvrxvsywtywQXTJ`gcT|y~|x}{rxvx~|RYUTdkhT                      rxvz}SZVTholT  '''''''%  rxv|SZVTlspT )) ) ) ) ) :(˲Vx\+!+"+",","" rxv~SZVTpwtT $/%/%0%0%0%0% ?,EfN1'1'2'2'2'' rxvSZVTt|xT '3(3(3(3(4(4(4)4)4)4)4)4)4)5)5)5)5*5*6*6**!  rxvTZWTx|T +"8,9_D:^E=.9-9-9-9-9-9-:-:-:-:-:.:.:.:.;.;..$ rxvT[WT|T 1'!@3W~cJsW%H6!A4!B4!B4!B4"B5"B5"B5"C5"C5"C5"C5"C6"D6"D64) u{yT[WTT/G=9XKYfζ[g*R=$H9$H9%I:%I:%I:%I:%I:%I:%I:%J;%J;%J;9. |U[XTT7NDEcWCbUEiVT{c}ʰä(O=%J:&J;&J;&J;&J;&J;&J;&J;&K<&K<&K<;/ U\XTT!>VLNmaNp`V}g|ʱ,UB'O?(O?(O?(O?(O?(O?(O?(P@(P@(P@(P@ ?2V\YTT$ F`VY|nzǮeuMucGn_:dS.ZI.ZH.ZH.ZH.ZH.ZH.[I.[I.[I.[I$G8V]YTT'"Mh]bwūh{YoV}mT{lRzjPxhKtc;hV1aM1aM1aN1aN1aN1aN1bN1bN&L<W]YTT)%Rlbi}sl~cxav_t\sZqX~oV}mU{lSzjLud=iW2aN0`M0`M0`M0aM0aM&L=X^[TT!,(Xshqomkig}e|czax_v]u[sYrWpT~mIvd>n[5gS3fR3fR(P@![b^TT#/*a}r|zxvtrpnljigec~a}_{]z[xTrLl6`O#_fbTT%1-gx~|zyvusqomkigedb`~Ipa*$cjgTT(3/k|~|zxvtrpnmkigeMrd-&gnkTT*51CUNOc[NbZMbZLbYKaYJ`XI`WH_VG_VF^UE]TD]SC]SB\RA[Q@[Q?ZP>ZO=YOGC=FC=FBHD>IE>IE>IE?JE?JF?JF?KG?KG@LGMXTnurP%szv%{㸾}p[ r0hxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)dhwͫww2ww)w./wH2|xX-office-spreadsheetorsproxyputsypdpdhlXw(0 ` %+))**)*)'+*"&%-30.31 .20.20.20 /20&/21+.10-.10./20,.10(.20".30.20/20 .31MSP PWSdFLIAFC@FC@FC@FC@EB@EB@EB@EB@EB@EB@EB@EB@EB@EB@FC@FCBHEMTPeMTP QXT syuҢz}^eaOVR Za]brxvrxvrxvqwurxvrxvqwurxvrxvrxvqwurxvqwuqyv{֨jqoqwu}rxvrxvz}QXTc_fc~w|{~~uzy~RYV~elh                SZVjrn &&''''A/^{c^{c_{d_{d_{d,G4(((( SZVpwt -#-#.#.$.$8XB¬¬?^I0%0&0&0% T[Wu}y  4)9+6*5*6*6*6*6*6+6+7+7+7+7,8,7+ T[W{ ;/AeM5XC >1=1>1>1 >1 >1 ?1 ?1 ?2 ?2 ?2 ?1 T[W4REOt\CjR$H8#F7$F8$F8$F8$G8$G8$G9$G9$F8 U\X HfZFfXGkYbpĨZi&L='M='M='M='M>'M>'N>'N>'M= V\Y% Ttg_p«Nwa/XH+UD+UD+UD+UD+UD+VE+VE+UDW]Y)$`t{atSyjPwgMteAjZ2_M/]J/]J/]K/^K/^K.]JW^Z!-(kpkdzax_v\sYqWoS|lFra9iV2dP2dQ2eQ2dP!Y`\$0,vurpmjhe~c|`z]w[uTpIyg@t_9nY$^ea(4/~{xvspnlifda~_|[x,%dkg+72|zwurpmkhd0)ipm~0:6/;6.:6.:5-95,94+94+83*82)72(71(61'60&60&5/%5/$4.'71nur~bpwtb s{w a}}}}}}}}}}}}}}}}}}a{ h r0ixiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)(  @" $'&&*) +-, +,, '+) %('!#"@FC1>DAZ:?=e:?[AFC2]d`YyuzxT[WYy~|z~}{~|~~~~~z{}sywdjg            ~gmj ,","-#\zcªªª3O=.$/% ~iol#?0#@16*6+7+7+7+7,8,8,~kqn)#CfR2VC#E7$E7$F7$F8$F8$G8&our(92Ii[[jɲ(O>'L='M='M='M>'N>*"tzw2E=oWlIqa8dS/]K/^K/^K/_L3(y|:MFoj~dz`v[sXpNxg@m[5eR2cP7,DXP{wsolhd`}Xw+G<@QKk|hzexbv`s]~qZ|oWzmTxjQwh/F=uzxqwuqvtrwusxvsywtzxu{yv}zw~{x|})ovs)h  r0jxiKaD5xi p] okd@N2D@@e25Md2N_4d2NNN2@`4oC:\Documents and `H|dT_2h|gf5|5s6|h wJ)dhwͫww2ww)w./wH2|xX-office-spreadsheetorsproxyputsypdpdhlXwJ)dh./ D(H @RYULROCIFDIFCIFCIECIECIECHECHEBHEBHEBHEBHEBGDBGDBGDAGDAGDAGDAGDAGCAGDAGCAFC@GCAFCAFCAFDAFCAFCAGCAFCAGCAFDAGDAGCAGDAGDAGDBGDBGDBGDBGDBHDBHEBHECHECHECIECIECIFCIGDIFCIFLROW^ZPWSOVROVRPWSQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQXTQWTQWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSOVROVROVROVRSZVT[WOVRpvs¿v{y^daOVRQXTV]YSZVʬ~qwtPWSQXT]c`SZVըv|zrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvqwupzvo~xpzvqwuntrmrptyw{}rxvrxvqwurxvrxv}qvtOVRSZVV]Yqwt֫rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzvSŌNӑRŌqzvjpnhmkqwurxvrxvsywtzxrxvrxvrxvrxvrxv}]d`OVRW^Zy}qwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvo}wʵNӐo}wjomdigqxvqxuqxurxu{~sywrxvqwurxvrxvqwusxwu{xNUQ]d`Y`\ȻrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzvTÌqzvjomchfqvtqwuqwurxvy~|sywrxvrxvrxvrxvrxvrxvOVRSYV`fc]d`Ӳtzxsywsxwrxvrxvrxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvrxvqwurxvqwurxvqwurxvqwurxvqwurxvrxvqwuqyvo}wqyvqwulrpbgechfejhkpnrvux}{}rxvrxvqwurxvrxvqwurxvRYUT[Wcif_fcճw}{v|zv|zu{yz}rxvrxvrxvrxvRYVU[Xelhahdֵ{~z}y~|rxvrxvrxvSYVU\Xfnjcjf׷~}JMK                                                    JNLqwurxvSYVU\Xholelhع                                                       rxvrxvSZVU\Xjqmgnjػ                                                      qwurxvSZVU\Xlsohplټ   "$$$$$$$$$$$$$$$%&&&&&&&&&&&&&&&&&%$$$$$$$$$$$$#   rxvrxvSZVV\Ymuqjqnھ   $&&&&&&&&&&&&&&& >(1Y75]<6]<6]<6]<6]<6]<6]<6]<6]=6]=6]=6]=6]=6]=6]=4[:%G-'('(((())()('   qwurxvSZVV\Yovslsp   () ) ) ) ) * * * * *!*!*!*!*!*!#C,ҫ̭(M1,",",",",#,#,#-#-#-#-#-#+!   rxvrxvSZVV]YqxunurÐ   ') ) ) ) ) ) ) ) ) ) ) ) ) ) ) "B+Ѳ'L0+!+!+!+!+"+"+"+"+"+"+"+"*    qwurxvSZVV]Yszwpwtœ   +"-#-#-#-#-#.#.#.#.#.$.$.$.$.$.$$F.ɤƧ(M2/%/%/%/%0&0&0&0&0&0&0&0&.$   rxvrxvSZVV]Yu|xryuǗ   0&2'2'2'2'2'3'3'3'3(3(3(3(3(3(3(%H12^<5`?5`?5`?5`?5`?5`?5a?5a?5a?5a?5a?5a?5a?5a?5a?0W;6*5)5)5)5*5*5*5*6*6*6*6*6*3(   rxvrxvSZWV]Yv~zs{wș~~~  -#/%/%/%/%/%0%0%0%0%0%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1'1'1'2'2'2'2'2'0%    qwurxvSZWV]Yx|u}zʝ}}}  3(5)5)5)5)5)5)5)5)5*6*6*6*6*6*6*6*6*6*6*6*6*6*6*6+6+6+6+6+6+7+7+7+7+7+7+7+7+7+7,7,7,8,8,8,8,8,6*   rxvrxvTZWV]Zz~w{̠{{{  8,:.:.:.'K5(N6 >/;.;.;.;/;/;/;/;/;/;/;/1 >1 >1 >1 >1;/   qwurxvT[WW]Z|y}ͣzzz   4)6*6*6*'L3N{W9fD(N4<,7+7+7+7+7+7+7+7+7+7+7+7+7+7+7+7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8-8-8-9-9-9-9-9-7+   rxvrxvT[WW]Z}{Ϧyyy   :.<0<0<0*Q8džDsO,V:#E3=0=0=0=0=1=1=1=1=1>1=1>1>1 >1 >1 >1 >1 >1 >1 >1 ?1 >1 ?1 ?1 >1 ?1 >1 ?1 ?2 ?2 ?2 ?2 ?2 ?2 ?2 ?2=0   rxvrxvT[WW^Z}ѩwww   !@3"C5"C5"C5-W=ҖQ]2aA(N:#E6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#F8#F8#F8$F8$F8$F8$F8$F8"D5   u{ytzxT[WW^ZҬvvv   'L6>1=0=0>0>0>0>0>0>0>1>1>1>1>1>1?1?1?1?1?1?1?1?1?2?2?2?2 @2 @2 @2 @2 @2=0   x~|w}{T[WX^Zԯuuu:WJ;YL8VI3RE9bI޲Եjs9kH,V=$G8#E7#E7#E7#E7#E7#E7$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$F8$G8$G8$G8$G8$G8#D6   |{~U[XX_[ֳttt!A`SCcVBcUAbTHpY`lϱ޿{?tO1aE)R?'N>'N>'N>'N>(N>(N>(N>(N>(N>(N>(O>(O>(O>(O?(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?&L=  ~U\XX_[׶rsr#@[PB^RA]Q@\P?[P@^PDgSHpUMyYjsԸ̂3eB"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D7"D7"D7#E7#E7#E7#E7#E7"C5  U\XY_\ٹqqq% GeXIh[HgZGfYFfXEeXDdVCcVCdUEhVHqYLy\Ygv7lH'M='L='L='L='M='M='M='M='M='M='M='M='M='M>'M>'M>'M>'M>'M>'N>'N>'N>'N>'N>'N>'N>'N>&K<  U\XY`\ۼppp!&"Mn`OrdOqcNpbMoaLo`Kn_Jn_Im^Ks_OzaSdftҵ:sM+VD+UD+VD+VD,VE,VE,VE,VE,VE,VE,VE,WE,VE,WE,WE,VE,WE,VE,WE,WF,WF,WF,XF,XF,WF,XF,WF*TC  V\YY`\ݿnoo "(#Lh]Nk_Mk_Lj^Ki]Kj]Nr_R{aZgs~ۤȪ;nL&L<%K<%K<%K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L=&L=&L=&L=&L=&L=%J;V]YZ`]×mmm!#)%RqeUuhTugStfX~ihuͱףȪiwPbHp];aQ.WF*TC*TC+TD+UD+TD+UD+TD+UD+UD+UD+UD+UD+UD+UD+UD+UD+UD+UE+VE+UE+VE+VE+VE+VE+VE*SB V]YZa]Ƙlll#$ +&Y{m\q[pZ~o`r˯КgwWjPyfLudKtcJscHqa=hW1_M0^L0^L0^L0^L0^L0^L0_L0_L0_L0_L0_L0_L0_L0_L0_L0_M0_M0_M0`M0`M0`M0`M0`M.\J V]YZa]ʙjkk$&" ,'WuiZxlYxkXwj^nʰɎbpU~fNqbLm`Km_Jl^Ik^Hk]Gj\Fi[BfW4ZK*RB)QA)RA)QA)RA)RA)RA)RA)RB)RB)RA)RB)RA)RB)RB)RB)RB*SB*SB*SB*SB*SB(P@!W]Z[a^˚ijj%!'#!.)^~qau`t_sevγÈev]pV|lUzkTyjSxiRwhQwhPvgOvfNueMteLsdLscEn]6bP/\J/\J/\J/]J/]J/]J/]J/]J/]J/]J/]J/]J/]K/]K/]K/^K/^K/^K/^K/^K-ZH"W^Z[b^ʙhhh&"($#0+ezh~g~f}kҷ޶׼k}dz_w^v]v\u\u[tZsYrXqWqVpUoTnTnSmR~lIwe;mY5hT5iT5iT5iT5iT5iT5iT5iT5iT5iT5iU5iU5iU5jU5jU5jU5jU5jU3eQ#W^Z[b^˘ggg(#*%$1,btewdwcviyyhxas]~q]~p\}o[|oZ{nY{mXzmWylVxkUxjTwiSwhRvhQugPtfPteOseNrdMqcLqbCiZ5^N-XF,XF,XF,XF,XF,XF,XF,XF,XG,XG,XG,YG,YG,YG,YG,YG+VE$W^Z\b_˗efe)$ +&&2-i}mlkopj~g|f|f{e{dzcybxaw`w_v^u]u\t[sZrZqYpXpWoVoU~nT}mT}lS|kLwe?mZ4fR2dP2dP2dP2dP2dP2dQ2dQ2dQ3eQ3eQ3eQ3eQ3eQ1aN%Y_[]c_ʗddd*%!,('4/pssrqponmlljjihgfed~c~c}b|a|`{`z_z^y]x\x[wZvYuYuVsL~kAva9q[8pZ8pZ8p[8p[8p[8q[8q[8q[8q[8q[6lW&  [a^^ea˖ccc+'"-)(50mppnmmlkj~i}h}g|f{fzeydycxbwav`v_u^t]s\s\r[qZpYpX~oW}nV}mU}mT|lS{kSzjQzjMwfDo^:hV2aO0`M0`M0`M0`M0`M0`M0`M/]K'!!\c``gcʕabb!,(#.*)71twwvutsrrqponmlkjiihgf~e~d}d|c|b{az`y_y^x]w\w[v[uZtYtXsWrUpL|iDvc=q\8mX6lW7mW6lW4iT( "!^eabie˕`a`"-)$/++83z~}|{zzyxwvuttsrqponmmlkjiihgfeddcba`~_~^}]|\|\{YyStKnFi>wa*!""`gddjgʔ___#/*%0,,94x|{zyxwvvttsrqponmlkkjih~g~f}e|e|d{czbyay`x_x^w]v\u[t[tZsYrXrWqWpUoUoTnPzi/('!&biffli˔^_^$0+&1--:5~~}||{zyxwvuutsrqpoonmlkkjihgfeddcb~a}`}_|^{]z]z\yWt 2+*$*#dkghnkʔ^_^%1,'2..<7~}|{{zyxwwvutssrqponnmlkjiihgfed`!4-+%+$fmiipm˔^_^&2-(3//<7~}|{zyxxwvutsrrqponmlkkjihgfe~d~c}b|b{a{`z_y^xZs"5-,&,%hokkro˔^_^'3/)401>9~}|{zzyxwvuutsrqponnmlkjihhgb$6/-'-'iqmmtpʔ^_^(40*512>:~~}|{{zyxwwvutssrqpponmmlg%70/(.(ksoovr˔^__)51+62,732?:2?:2?:2?91>91>91>90>90>90>8/=8/=8/=8/=8.=7.=7.=7.<7-<6-<6-<6,<6,<6,;6,;5,;5+;5+;5+;4*;4*:4*:4*:4):4):3):3(93(93(93'92'92'92'92'82&81&81&81%70 0*/).(mtqqxtʙ___.95,73,62,73,62+72+62+62+62*61*61*51*61*51)51)50)50(50(40(50(4/(4/'4/'4/'3/'4/&4/&3.&3.%3.%3.%2-%3-%2-$3-$2-$2-$2-#1,#2,#1,#1,#1+"1,"0+"1+"1+!0+!0+!0*!0* 0* 0* 2+ovsryv˱aaaHOM/:60;70;70;70;6/:6/:6/:6.:6.:5.:5.:5.95-95-94-94-94,94,84,84,84+83+83+83+83+83*82*82*82*72)72)72)72)72)72(71(71(71(61(61'61'61'60'60'60&50&50&50&5/&5/&5/'61Tb]pwsszwʐ```\^]]`^]`_]`_]`_\`^\`^\`^\_^\_^\`^]`_^a`^ba_ba`cbadcaecbfdcfedgfdhgeigfihgjihkjhljimkjmlknmkonlpomqonqpnrqosrptrqusrutsvuswutxvuxwvyxvzyw{zx|zy}{z}|{~}{~jqnryvʲjro뎔ovs칽pxt}v~zu}yȔu}yx}}x}y}(@2HPK=C@>C@=B?=B?=B?=B?=B?;A>;@><@>;A><@=;@>;@=;@=;@=<@=;@=;@><@=;@>;@>;A>C@>C@=D@SYUOVROVRPWSQXTQXTQXTQXTQXTQXTQWTQWTQWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSPWSOVROVROVRPWS\b_OVRgmi¾uzxZ`]OVRU\XQXTҿ~~||z~z~}gmjOVRU\Xv|y֤rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzveeqzvntrlpnsxvx}{~|rxvrxvrxvrxv|`fcOVRV]Yrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxve~xNٔe~lrpfkiqxuqxurxurxv|rxvrxvrxvrxvrxvOVR\c`hnkۍrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvwye~lrpchfrxuqwurxvqwuz}rxvrxvrxvrxvrxvv|zY_\RYU^eb{~~sywrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqyvwf~qyvmsqchfgljjomotrtyw~v|zrxvrxvrxvrxvrxvrxvagdRYUahe~v|zu{ytzxw|z|}}~~~x|zuyxvzxz}|y~|rxvrxvrxvrxvcifSZVdkgႇz}y~|rxvrxvrxvdjgSZVfmiᅊ}~>B@                                              =B@{~rxvrxvdjgSZVhok≎                                                rxvrxvekhSZVjqm㌑                                               rxvrxvekhSZVlso䏔  %%%%%%%%%%%%%%2"9%9%9%9%9%9%9%9%9%9%9%9%9%9%9%/!%%%%%%%&&&&   rxvrxvfliSZWnuq咗  ((((()))) ) ) ) ) ) &J/qu#D,+!+!+!+"+"+",",",",","   rxvrxvfliTZWpws喚  ) ) ) ) ) * * * * *!*!*!*!*!&J/ܾĥ#D,+!+!+!,",",",",",",","   rxvrxvgmjT[Wryu晝  ,",",",","-"-"-"-"-#-#-#-#-#'L1ܾޣť$F..$.$.$.%.%.%/%/%/%/%/%  rxvrxvgmjT[Wt{w眠  2'2'2'2'2'3'3'3'3(3(3(3(3(3()N47cA9dC9dC9dC9dC9dC9eC9eC9eC9eC9eC9eC9eC9eC0W<6*5)5)5)5*5*5*6*6*6*6*6*  rxvrxvhnkT[Wu}y蠤~~~  /%/%/%/%/%0%0%0%0%0&0&0&0&0&0&0&0&0&0&0&0&1&1&1&1&1&1&1&1&1&1&1&1&1&1'1'1'2'2'2'2'2'   rxvrxvhnkT[Ww|飧}}}   6+6+6+7+6+7+7+7+7+7+7+7+7+7,7,7,8,8,8,8,8,8,8,8,8,8,8,9,9,9-9-9-9-9-9-9-9-:-:-:-:-:-   rxvrxviolT[Wy~馪{{{  9-9-9-%G3.Z:%G3:-:-:-:.:.:.:.:.:.:.;.;.;.;.;.;/;/;/;/;/;/;/;/;/;/;/;/;/<0<0<0<0<0<0<0<0!  rxvrxviolT[W{ꪭzzz  7+7+7+#E1ltqx3_>%H28,7,7,7,7,7,7,7,8,8,8,8,8,8,8,8,8,8,8,9,9,9,9,9,9,9,9-9-9-9-9-9-9-9-!  rxvrxvjpmT[W}뭱xxx  #"B5"B5"B5)P:˂?pL,V=$F6#C5#C5#C6#C6#C6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E6#E6#E7#E7#E7#E7#E7#E7#E7#E7$F7$F7$F7$F7$F7%  sywsywjpmU[X찳www  " ?2 ?2 ?2'L7ԑIxT-W;#E4 ?2 ?2 ?2 @2 @2 @2 @2 @2!@3!@3!@3!@3!@3!@3!A3!A3!A3!A3!A3!A3!A3!A4!A4!A4!B4!B4!B4!B4!B4%  w}{v|zkqnU[X촷uuu/(6SG3PD/M@1WAܟãV`/\?&J8"B5"C5"C5"C5"C5"C5"C6"C6"C6"C6"C6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6"D6#D6#D6#D6#D6#D6&  {~z}mspU\Xttt$5.CdVBcUAbTEkWdpػҳgs6jH-XA'N>'N>'N>'N>(N>(N>(N>(N>(N>(N>(O>(O>(O?(O?(O?(O?(O?(O?(O?(O?(P?(P?(P?(P?(P?*"  ~}ntqU\Xrsr%5.B^SA]R@]Q?\P@^PCgRGoUQ}]u~ܿ\f(P:"D6"D6"D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#D6#E7#E7#E7#E7#E7#E7#E7#E7(  ourU\Xqqq(:3Kk^Jj]Ii\Hh[GhZFgYEfXDeWFjXIr[O_]k܆.[C(O?(O?(O?)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)P@)QA)QA)QA)QA)QA)QA)QA)QA,#  qvsV\Yüppp!+=6PpcNobMnaMm`Km_Jl^Jm^Nu`Q~b]lͰ熲/^E)RB)RB)RB*SB*SB*SB*SB*SB*SB*SB*SB*SC*SC*SC*SC*SC*TC*TC*TC*TC*TC*TC*TC*TC.%rwuV]Ynnn!",=6PmaOl`Nk_Nm_SxbWenzٿ֚Zg3[G&K<&K<&K<&K<&K<&K<&K<&K<&K<&L<&L<&L<&L<&L<&L<&L<&L=&L=&L='M='M='M='M='M=-#syvV]YŦmmm"$ 0D<[~pZ~oY}n\pД`qRgKucIrbCn\5bP/^K0^L0^L0^L0^L0^L0^L0_L0_L0_L0_L0_L0_L0_L0_M0_M0_M0`M0`M0`M0`M0`M3)tzwW]Yɨklk$%!1D=[{nZzmYyl\nũƉ\lS{fMpbKoaJn`In_Hm^Gl]=dU/XH+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE+VE,WE,WE,WE,WE,WE1'v{xW]Z˩jjj%!'#4F?_s_r]~qasǬڿ`pXkSvhRvgQufPteOsdNrdMrcKqbJpaIo_RJsrqponmlkjihgf~e}d|c|b{az`y_x^x]w\v[uZuYtXsWrVqQlEvc:nZ6kV6kW6kW6kW6lW6lW6lW6lW6lW;/  ~[a^˧bcc ,'".)?QJrqponmlkj~i}h|g|f{ezdycxbwav`u_u^t]s\r[qZpYpX~oW}nV}mU|lT{kSzjRyjLudAm\7eS1`M0`M0`M0`M0`M0`M9-!!Ԁ]d`˦aaa!-)$/+CXP~}|{zyxwvuttrrqpnnmlkjihgfedcba`~_~^}]|\|ZzTtLnDh>{c=zb!A4""ւ_fb˦_``#/*%0,DWP}|{zyxwvutsrqponmlkjiihgf~e}d}c|a{a{_z^y^x]w\v[vYuYtXsWrUqPm*F;%$مahd˦^__$0+&1-FYR~}|{zyxwvutsrqponmmlkjihgfed~c}b|a{`{_z^y]y\x[wZvYu1KA*$)#ۇcjf˦^__%1-'2.J^W~}|{zyxwwvutsrqponmlkjihhgfed5RG+%+$މelh˦^__&2.(3/J\U~}|{zyxvvutsrqponmlkjihgfe~d}c|b{a{`z_y^x4ND,&,%gnj˦^__(3/*50MaZ~~||{zyxwvutsrqpoonmlkji9UJ.'-'⎓ipl˦^__)50+61DUOssrqpponnmllkji~h~h}g}f|f|e{e{dzczbybyax`x`w_w^v]v]u\u[t[tZsYsXrXrWqVp3LB/).(䐕kro˦^__*51,73,72+62+62+62*61*61*51*51*51)51)50)50(50(50(4/(4/'4/'4/'4/&4/&3/&3.&3.%3.%3.%3-%3-$2-$2-$2-$2-#2,#1,#1,"1,"1+"1+"1+"1+!1+!0+!0* 0* 0* 0*/)撗mtq˴```7B>-73-73,73,73,73+72+72+62+62+62*61*61*51)51)51)50(50(50(50(4/'4/'4/'4/'4/&3/&3.&3.&3.%3.%3-%3-$2-$2-$2-$2-$2,#2,#1,#1,"1,"1+"1+"1+!1+!0+!0*0B;蔙ovr}}}\^]MSQOVTOVSOVSOVSOVSNVSNUSNUSNUSOVSOVTOWTPWTPXUQXUQXVRYVRYWRZWS[XS[XT\YT\YU]ZU]ZV^[V^[W_\W_\X`]X`]Ya^Yb^Zb_Zb_[c`[c`\da\ea]eb]fc^fc^gc_hdbifꌒovsȜw~{u|yltq〇v~zڇs|xʼw|x}~}|{z~?(0`SZVOVROVRPWSPWSPWSPWSPVSPVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROVROUQQWT[a]X_[Ŀ¾pvsSZVT[WZa]u{yuzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtzxtyxtywtywsywsywsywsywsywsywsywr|xr|xsywotsw|zsywrxvuzy~SZVZa]rxvqwurxvqwuqwurxvqwurxvqwuqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqwuqwurxvqzvhҞQ͏pyufkiqxvrxvsyvsywrxvqwurxvpusQXTY`]ʄrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvqzviҞpyuchfqwuqwurxvsywrxvrxvrxvtzxOVR]d`{tzxsywrxvsywsywsywsywsywsywsywtywtywtywtywtzxtywtywtzxtywtywtzxtywtywtzxtywtywtzxtyws{xs{xtywhmkejhjomsxv{~tzxrxvqwuqwurxvQXT`gcy~||rxvrxvQXTcjfۄ}&+)                                  %*(sywrxvQXTemi܈                                    v{yrxvQXTholݍ  #$$$$$$$$$%2"3"3"3"3"3"3"3"3"3"3"3"&$$$$$%%$  v{yrxvQXUkroޑ  '))) ) ) ) * * * ,!Y_¤åååååååååin2$+"+",",",",","+!  v{zrxvRXUnuqߖ  (* ) * * * * *!*!*!,"ns2%+"+",",",",","+!  v{yrxvRYUpwt᚞  0&1'1'1'2'2'2'2'2'2'4(AkJ`g`h`g`g`h`h`h`h`h`hBfL6)4)4)4)4)5)5)5)3(   v{yrxvRYUs{w⟣  /%0%0%0%0%0%0&1&1&1&1&1&1&1&1&1&1'1'1'1'2'2'2'2'2'2'2'2'3'3'3'1'   v{zrxvRYUv~z㣧}~}  8,:-;.&H3;.:-:.;.:.:.;.:.;.;.;.;.;/;/;/;/1?1?1?1?1 ?2 ?2 ?2 ?2 ?2 @2 @2 @2 @2 @2 @3 @3 @3 @3 @3 ?2  }x~|RYU赸wwwA`SAaT@aSfrͰԈBrR,W@'M='L='L='M='M='M='M='M='M='M>'M>'M>'N>'N>'N>(N>(N>(N>'L=  }SZV麼uuu!B^RB_SA]Q@^QCfSHoVdoӷy'N:"E6"E6#E7#E7#E7#E7#E7#E7#E7#E7#E7#E7#F8#F8#F8#F8#F8"D6 SZVstt$ Mn`NobLn`Km_Jm^Hl]Jp]O|aerâ/]F*TC*TC+UD+UD+UD+UD+UD+UD+UD+UD+UD+VD+VE+VE+VE+VE+VE*TC SZVĻrrr!&!Mj^Nl`Mk^Pr`U}dur}.VC&K<&K<&K<&K<&K<&K<&L<&L<&L=&L<&L=&L=&L=&L='M='M='M=&K<SZVppp#($Y|nZ~pY~o~TiLvdIrb@jY2`M0^K0^K0^K0^K0^K0_K0_L0_L0_L0_L0_L0_L0`L0`L0`L/]JT[Wnoo% *&YwkZymYylжuU}gNqbLnaKm_Il^Hk]EiZ8^O+TC*SB*SB*SB*SB*SB*SB*SB*SB*SC*TC*TC*TC*TC)RAT[Wlmm'"!-(ezf|e{ުβvbx]u[tZsYrWpVoUnS~mR~lNzh?o\4gS4gR4gR4gS4gS4gS4gS4hS4hS4hS4hS4hS3eQ!T[Wkkk)$#/*dvfxew|pcu_r]q\~pZ|oY{nWzmVykUxjSwiRvhQugPteNsdIo`;dS/[I-YG-YG-YG-YG-YH-YH-ZH-ZH-ZH,XF"U[Xiii*&%1,prppnlkjigfd~c}b|`{_z^y]x\wZvYuVrK}i?t_8oY7oY7oZ8oZ8pZ8pZ8pZ6mW$ W^Zggg!,(&3.oqonmkj~h}g|fzdycxaw`v_u]s]s[qZpX~oW~nU}mT|lSzjNwfCo^9gU1aN0`M0`M0`M/^L%!Za]eee".)(50{}|zyxwvtsrponmkjihfedba`~_}]|[{UuMoFi>xb'"\c`cdd$0+*62z|{yxwutsqpomljihg~f}d|c{ay`y_w]v\u[tYsXrWqVpR}l-''!_fcccc%1-,84~}{zywvutsrponmkjigfed`0*+$bieccc'3.-:5~}|zyxvutsqpomlkihged~c}a|`{\w!2+,&elhccc)40/;7~}|{zxwvutrqponmh#4-.(gokccc*61,730<70<7/<7/;7/;6.;6.;6-:6-:5,:5,:5,:4+94+94*93*93*83)83)82(82(82(71'71'71'71&60&60%60%6/%6/$5/$5. 0*/)jqnooo:D@/:5/:5.95.95-95-94-84-84,83,83+73+73*73*72*72*72)61)61(61(61(51(50'50'50'5/&5/&4/&4/%4/%4.%4.$4.$4.$3-9ICltpʯoppaccbdcbdcadcadcadcadcbddcfedgffhggihhjiikkjmlknmmonnpooqqpsrqtssuttvuuxwvyxwzyy{zz|{{~}|~}kroݶszwy}Ế~{( @ QXTIPLGMJGMIGMIFLIFLIFLIFLIFLHFLHFLHFKHFKHFLHFKHFLHFLHFLHFLIFLIFLIFLIGMIFMINUQY`\~fliSZVx~{rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvmbkpntywy~|rxvrxv}_fb|rxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvrxvmhmkmsqrwu}rxvrxvsywtyw`gc|y~|x}{rxvx~|RYUdkh                      rxvz}SZVhol  '''''''%  rxv|SZVlsp )) ) ) ) ) :(˲Vx\+!+"+",","" rxv~SZVpwt $/%/%0%0%0%0% ?,EfN1'1'2'2'2'' rxvSZVt|x '3(3(3(3(4(4(4)4)4)4)4)4)4)5)5)5)5*5*6*6**!  rxvTZWx|¥ +"8,9_D:^E=.9-9-9-9-9-9-:-:-:-:-:.:.:.:.;.;..$ rxvT[W|Ŭ 1'!@3W~cJsW%H6!A4!B4!B4!B4"B5"B5"B5"C5"C5"C5"C5"C6"D6"D64) u{yT[Wdz/G=9XKYfζ[g*R=$H9$H9%I:%I:%I:%I:%I:%I:%I:%J;%J;%J;9. |U[Xʺ7NDEcWCbUEiVT{c}ʰ۞ä(O=%J:&J;&J;&J;&J;&J;&J;&J;&K<&K<&K<;/ U\X‰!>VLNmaNp`V}g|ʱ瘼,UB'O?(O?(O?(O?(O?(O?(O?(P@(P@(P@(P@ ?2V\Yɉ$ F`VY|nzǮeuMucGn_:dS.ZI.ZH.ZH.ZH.ZH.ZH.[I.[I.[I.[I$G8V]Ỷ'"Mh]bwūh{YoV}mT{lRzjPxhKtc;hV1aM1aM1aN1aN1aN1aN1bN1bN&L<W]Ẏ)%Rlbi}sl~cxav_t\sZqX~oV}mU{lSzjLud=iW2aN0`M0`M0`M0aM0aM&L=X^[̅!,(Xshqomkig}e|czax_v]u[sYrWpT~mIvd>n[5gS3fR3fR(P@![b^̃#/*a}r|zxvtrpnljigec~a}_{]z[xTrLl6`O#_fb̂%1-gx~|zyvusqomkigedb`~Ipa*$cjĝ(3/k|~|zxvtrpnmkigeMrd-&gnk̂*51CUNOc[NbZMbZLbYKaYJ`XI`WH_VG_VF^UE]TD]SC]SB\RA[Q@[Q?ZP>ZO=YOGC=FC=FBHD>IE>IE>IE?JE?JF?JF?KG?KG@LGMXTʼnurʭԤ{(0 PWSFLIAFC@FC@FC@FC@EB@EB@EB@EB@EB@EB@EB@EB@EB@EB@FC@FCBHEMTPsyuz}^eaZa]rxvrxvrxvqwurxvrxvqwurxvrxvrxvqwurxvqwuqyv{֨jqoqwu}rxvrxvz}QXT_fcw|{~~uzy~RYVelh                SZVjrn &&''''A/^{c^{c_{d_{d_{d,G4(((( SZVpwt -#-#.#.$.$8XB¬¬?^I0%0&0&0% T[Wu}yÌ  4)9+6*5*6*6*6*6*6+6+7+7+7+7,8,7+ T[W{ȏ ;/AeM5XC >1=1>1>1 >1 >1 ?1 ?1 ?2 ?2 ?2 ?1 T[WΒ4REOt\眹CjR$H8#F7$F8$F8$F8$G8$G8$G9$G9$F8 U\Xԕ HfZFfXGkYbpĨZi&L='M='M='M='M>'M>'N>'N>'M= V\Yٗ% Ttg_p«Nwa/XH+UD+UD+UD+UD+UD+VE+VE+UDW]Yݙ)$`t{atSyjPwgMteAjZ2_M/]J/]J/]K/^K/^K.]JW^Zݗ!-(kpkdzax_v\sYqWoS|lFra9iV2dP2dQ2eQ2dP!Y`\ݕ$0,vurpmjhe~c|`z]w[uTpIyg@t_9nY$^eaݔ(4/~{xvspnlifda~_|[x,%dkgݔ+72|zwurpmkhd0)ipmݘ0:6/;6.:6.:5-95,94+94+83*82)72(71(61'60&60&5/%5/$4.'71nurėpwtӔ( @>DA>DA:?=:?<:?<:?<:?<:?<:?<:?<:?<:?=>DA]d`yuzxT[Wy~|z~}{~|~~~~~z{}sywdjg            ~gmj ,","-#\zcªªª3O=.$/% ~iol#?0#@16*6+7+7+7+7,8,8,~kqn)#CfRӄ2VC#E7$E7$F7$F8$F8$G8&our(92Ii[[jɲ(O>'L='M='M='M>'N>*"tzw2E=o۔WlIqa8dS/]K/^K/^K/_L3(y|:MFoj~dz`v[sXpNxg@m[5eR2cP7,DXP{wsolhd`}Xw+G<@QKk|hzexbv`s]~qZ|oWzmTxjQwh/F=uzxqwuqvtrwusxvsywtzxu{yv}zw~{x|}Đÿ(Hd,T4|\\\,,P|ԴD`X\d$DDDL|\4lLDTL|Ȭ,XHxXxpXth$D,xxĤttt d,4, 8b""FBSS6b8 &^^^^^^^^^^^^^^^ 8b""FB"S8 &JIIIIIIIIIIIIIJ  08b""FB""80  +++++++++++++++! CCCCCCCC 08b""FB""8"0CCCCCCCCC5555555555555550008b""FB""8"0 CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC000bb""FB "OHH8"000>>>>>#00bb""FB "OGG8"00#>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>#00bb""8FB ;OGGb"00#]a>>>>>>>>>>>>>>>>>>#00bb""8FB ;MM6"00#>>>>&+ *>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>##0bb""8FB;L"###YJJ^NaUUUUUUUUU###66""bGFB;L"###>>>>&JIIJ! >>>>>>>>>>>>>>>>>>>>>>>>>>>>###6""6GF;L"###RRR4QNJIIIJ `UUUUUUUUUUUUUUUUUUUUUUUU###6 GB;L"## EEEE. &^JJIJ aUUUUUUUUUUUUUUUUUUUUUUU###6MB;L33"## RE*`& ^JJ+ a###6B8:22"## . EEE*. W!++UUUUUUUUUUUUUUUUUUUUUUUUUUUU###6Bb8922"# ........../& ^J+4444444444444444444444444444###68GB6b< ....... -NJJIJ!UUUUUUUUUUUUUUUUUUUUUUUUUUUU###6b8GB66< ._..`&^JIIIJ^!`.Q444444444444444444444444444###6663B66;< (JIIIJJ^!/\....QQQQQ ##6M2B6;OO< D_ JIIJ+&(......''E44444444444444444444444 ##62B;OO< ((((JJc&/(\\\\__......'Q ##6PB;OO< (Z((`  @`/(((((((((\\\\\\\.'Q ##6B;OO ((((Z&`(\\\___.......'44444444444444444 ##6GGB;OO DZWZ((((((((((((((((((\\\\\\.'QQQQQQQQQQQQQQQ ##6HGG2H;OO 1WWW11/(((((((((((((((\)'''''''''''' 6HG2OGH;OO %Z11ZZZZ(((((((((((((((\\\\\\\.'QQQQQQQQ bHMM2OGG;OO%1WWWWWW1111((((((((((((((((((\\)''' bGO=GG;OO%,,,,,,,,,,VWWWWWWWW$$$$$$$/////((([))' bGL=GG;OO%7WW1111111ZZ((((((((((((((((((\\\\\\ 8GL=<GG;OO%,,,,,,,,,,,,,,WWWWWWWWW$$$///(((((((\ GL=<GG;OO%KKK@@,,,VVVVVVVWWW$$$$$$$$$$$$$$ G23OL>>>>>>>GLS"GG;OO%%%%%%%%%%%%%%%%%%%%%%GL;S"GG;OO%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%%B8OO;""GG;;OOO==<<<<<<<>>>>>>>>>>>>>>>>>>>>>>>>> 33  2>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> 33  2>>>>>>>>>>>>>>>>>>>>>>>>>> 33  2OG@2@ 33 ',' !!  2OD@ !! >>>'IHIZY>>> !! 2OD2@ !!JIHHHI#)Q !!  ND26@ !!FFF*0BIIHI 0QQQQQQQQQQQQQQQQQQQQ !! ND2672 !!SF*)/#IIB  !! ND2M62 !!^1111& F&1) ',VQQQ !!  D 262 ! ^11111111) 'ZIV !! 6 D 22< ^1111))[BIIHIZ# QQQQQQQQQQQQQQQQQQQQQQQQ !! 6 D L2< .$JZIHHHIZ0)11&R"""""""""""""""""RRRRR!! @ M D LL< . #IHHII,J )11111&R"%!! @A  DALL< .$$#IIB'$\111111111R"""""""""!! @@@ D@LL< PT$$[ '[$$$$$$$$XXXXXX(&>!! @@@L D@LL P$$$$U$$XXX\\1111111R"!! 2L @LL CP]TT$$$$$$$$$$$$$$$$XXXX&&>!! 222LLL2 S5555$$$$$$$$$$$$$$$$XXX&&> 222K27LL2CS555TTTT$$$$$$$$$$$$$XXXXXX1&RRRRRRR> 2K27LL2UUUUUUUE]]]]]]]44444400000$$W(( 2K26LL2------]]]]]555$$$$$$$$$$$$$$$$XXXQ 2=26LL2UUUUU-----]]]]]]]50$$$$$$$$$$$$$ 2=26LL2+++UUUUEEEEEE44444444444 267 <26LL2?UUUUUU-------]]]]5555$$$$$$$$$$ 66 <26LL2?? +++++++++UUUUUUEEEEE4444444S M6; O26LL2??555555TTTTT$$$$$$$$$$$$$$$$$$$$$$$XX; O26LL2??????????????????; N26LL.????????????????????. LLAN2KLL GGGGGGGDDDDDDDDDD== LLL N22LL@ @@@@@@@LLK 2KLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL;N22KLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLK;; 22;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;; 226KKKKKKKKKKKKKKKKKKKKKKKKLLLLL62 2222222222222222222222@@@@AAA -?(0` d,\D40PȈ\\\\\д$8D@'C6 (///=NM$$$$MMM$ ++C>'C;(/IIINNNN*Q$ ++C+C;%------<=====HHH +C(%-=/////IN +C(%PPPPPPPPPP---<<<<<==( 17+C(%-----------====//( 006+C%%888888888PPPPPPPPPPPP<<<<<<<(; 06+C%%%%%%%%%%%%%%%%%%%%%%%%(((((;G+CC6 %%%%%%%%%%%%%%%%%%%%%%(((((((((( CF+4CF7666666GF " CG+CCCCCCC0 +CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC"++40+++++++++++++++++++'''''''' ( @d(P<\\\,(######9999/0, 2 ;;;;%044 %<<<<<50005555(0Tl,TDxШ\d\,||4dTd@DDxltt40|Dt`  dtXx`<($,(@dLLTT|$D4,40Xx8XD`hh0(ppxxxPtddxhphDdXDpX 01,,))))),.3.)'#3 )  )$$)((((((((((((((),)6 ))444 ,)&/%&//4&+2// #1&++++ 6 1 0& +++ 2""00&!55*+++ (30&!!!!!!!!!!!!0&10-&&&&&&&&&&&&&&&&&&&0001,,))( @uzxqwuqvtrwusxvsywtzxu{yv}zw~{x|}@QKk|hzexbv`s]~qZ|oWzmTxjQwh/F=DXP{wsolhd`}Xw+G<:MFoj~dz`v[sXpNxg@m[5eR2cP7,2E=oWlIqa8dS/]K/^K/_L3(y|(92Ii[[jɲ(O>'L='M='M>'N>*"tzw)#CfR2VC#E7$E7$F7$F8$G8&our#?0#@16*6+7+8,8,~kqn ,"-#\zcªª3O=.$/% ~iol      gmjy~|z~}{~|z{}djg]d`yT[W>DA:?=:?<,,,999EEERRR___lllxxxʦ>]|$$HHll>](|2<FU$mHl*>?]T|i~$Hlwyz{|}~Ijklmnopqrsttuvwx[\]^_`abcddefghiLMNOPQRSTUVVWXYZ=>?@ABCDEFGHIJK./0123456789:;< !"#$%&'()*+,- 'Parameterformat ist nicht korrekt - %c Ungltiger Parameter - /%c Zu viele Parameter - %s Pfad wurde nicht gefunden Datei wurde nicht gefunden Bentigter Parameter fehlt Ungltige Laufwerksangaben Ungltiges Parameterformat - %s &Ungltiger Befehl oder Dateiname - %s %Fehler: Zu wenig Speicher verfgbar. AFehler: Cannot pipe! Temporre Datei kann nicht geffnet werden! &Drcken Sie eine beliebige Taste . . .&Formato del parmetro incorrecto - %c Parmetro incorrecto - /%c Demasiados parmetros - %s Ruta no encontrada Archivo no encontrado !Prmetro requerido no encontrado !Especificacin de unidad errnea "Formato de parmetro errneo - %s )Comando o nombre de archivo errneo - %s Error fuera de memoria. GError! No se puede apilar! No se puede abrir el archivo temporal! $Pulsa una tecla para continuar . . .#Format du paramtre incorrect - %c Paramtre invalide - /%c Trop de paramtres - %s Chemin non trouv Fichier non trouv Paramtre requis manquant Lecteur spcifi introuvable #Format de paramtre incorrect - %s (Commande ou nom de fichier inconnu - %s Pas assez de mmoire. NErreur ! Impossible de chaner ! chec l'ouverture du fichier temporaire! +Appuyez sur une touche pour continuer . . ."Formato del parametro errato - %c Selezione non valida - /%c Troppi parametri - %s Percorso non trovato File non trovato Parametro obbligatorio mancante Disco non valido &Formato dei parametri non valido - %s #Comando o nome di file errato - %s Errore di memoria esaurita. IErrore! Impossibile ridirigere! Impossibile aprire un file temporaneo! #Premi un tasto per continuare . . ."Parameter format ikke riktig - %c Ugyldig bryter - /%c For mange parametere - %s Stien ble ikke funnet Filen ble ikke funnet Obligatorisk parameter mangler Ugyldig stasjon angitt Ugyldig parameter format - %s !Feil kommando eller filnavn - %s Feil: Minne fullt. ?Feil! Kan ikke bruke datakanal! Kan ikke pne midlertidig fil! #Trykk en tast for fortsette . . ."Parameter format not correct - %c Invalid switch - /%c   - %s            Invalid drive specification     - %s     - %s Out of memory error. 3! Cannot pipe! Cannot open temporary file! .     . . ."Parameter format not correct - %c Invalid switch - /%c Too many parameters - %s Path not found File not found Required parameter missing Invalid drive specification Invalid parameter format - %s Bad command or filename - %s Out of memory error. 2Error! Cannot pipe! Cannot open temporary file! Press any key to continue . . .A paramter megads hibs - %c rvnytelen kapcsol - /%c Tl sok paramter - %s Az elrsi_t nem hallhat Az llomny nem tallhat !Egy szksges paramter hinyzik rvnytelen meghajt #rvnytelen paramter megads - %s *Ismeretlen parancs vagy llomny nv - %s Nincs elg memria. 6Error! Cannot pipe! Cannot open temporary llomny! -A folytatshoz nyomj meg egy billentyqt . . .00000n0f_L0Uc0f0D0~0Y00 - %c !qRj00000g0Y00 - /%c 00000L0YY0N0~0Y00 - %s 00L0d0K00~0[000 0000L0d0K00~0[000 _j000000L0 NW0f0D0~0Y00 !qRj00000c[g0Y00 !qRj000000n0f_g0Y00 - %s 0000~0_0o00000 TL0Uc0f0D0~0Y00 - %s 000 N0000 000! 000g0M0~0[00! NBf00000Q0~0[00! }LY00k0o0UOK0000bW0f0O0`0U0D0 . . .%Format parametrw nieprawidBowy - %c NiewBa[ciwy argument - /%c Zbyt wiele parametrw - %s Zcie|ka nie zostaBa znaleziona Plik nie zostaB znaleziony Brak wymaganego parametru NieprawidBowe okre[lenie napdu "NiewBa[ciwy format parametru - %s +NieprawidBowa komenda lub nazwa pliku - %s BBd - brak pamici. 5BBd potokw! Nie mo|na otworzy pliku tymczasowego. /Naci[nij dowolny klawisz, aby kontynuowa . . .#5:>@@5:B=K9 D>@<0B ?0@0<5B@0 - %c 525@=K9 ?0@0<5B@ - /%c !;8H:>< <=>3> ?0@0<5B@>2 - %s CBL =5 =0945= $09; =5 =0945= !BACBAB2C5B =5>1E>48<K9 ?0@0<5B@ H81>G=>5 >?@545;5=85 48A:0 H81>G=K9 D>@<0B ?0@0<5B@0 - %s 15?@028;L=0O :><0=40 8;8 =525@=>5 8<O D09;0 - %s 5E20B:0 ?0<OB8. KH81:0! 52>7<>6=> 8A?>;L7>20BL pipe! 52>7<>6=> A>740BL 2@5<5==K9 D09;! +;O ?@>4>;65=8O =06<8B5 ;N1CN :;028HC . . ."Parameter format not correct - %c Invalid switch - /%c Prlia ve>a parametrov - %s Path not found File not found Required parameter missing Invalid drive specification Invalid parameter format - %s Bad command or filename - %s Chyba (z) nedostatku pamte. 2Error! Cannot pipe! Cannot open temporary file! ,Pokra ujte stla enm >ubovo>nho klvesu ..."Format parameter tidak benar - %c Saklar tidak benar - /%c Terlalu banyak parameter - %s Path tidak ditemukan File tidak ditemukan !Parameter yang diperlukan kurang Spesifikasi drive tidak benar "Format parameter tidak benar - %s #Perintah atau nama file salah - %s Kesalahan kekurangan memori. FSalah! Tidak bisa melakukan pipe! Tidak bisa membuka file temporal! $Tekan tombol untuk melanjutkan . . .#5?@028;L=89 D>@<0B ?0@0<5B@0 - %c 52V@=0 >?FVO - /%c 01030B> ?0@0<5B@V2 - %s (;OE =5 7=0945=89 $09; =5 7=0945=89 V4ACB=V9 >1>2'O7:>289 ?0@0<5B@ Invalid drive specification Invalid parameter format - %s $52V@=0 :><0=40 01> V<'O D09;C - %s 54>AB0B=L> ?0<'OBV. 2Error! Cannot pipe! Cannot open temporary file! 00B8A=VBL 1C4L-O:C :;02VHC 4;O ?@>4>265==O . . .Laufwerk ist nicht bereitLa unidad no est listaLecteur non prtDisco non prontoStasjonen er ikke klar    Drive not readyA meghajt nem ll kszen0000n0nPL0g0M0f0D0~0[000Napd nie jest gotowy#AB@>9AB2> =5 3>B>2>Drive not readyDrive tidak siap@8AB@V9 =5 3>B>289JNJNASNSNTONONTSNSNTYNYNAYNYNAYNYNAININMYNYNATNTNZYNYNAYNYNAYTYTSYNYNA:Die Befehlszeile ist zu lange nach der Alias-Erweiterung! @Es trat ein Fehler auf, whrend die Batch-Datei geffnet wurde. Aktive Code-Page: %u @Linea de comandos demasiado larga tras la expansin del alias! $Error abriendo el archivo por lotes Pgina de cdigos activa: %u =Ligne de commande trop longue aprs remplacement de l'alias! &Erreur l'ouverture du fichier batch Page de codes actuelle : %u =Linea di comando troppo lunga dopo l'espansione degli alias! &Errore durante l'apertura di un batch Tabella dei codici attiva: %u /Kommando linje for lang etter alias utvidelse! Feil ved pning av satsvis fil Aktiv tegntabell: %u -Command line too long after alias expansion! Error opening batch file Active code page: %u -Command line too long after alias expansion! Error opening batch file Active code page: %u /A parancssor tl hossz az alias kibontsakor! $Hiba a batch llomny megnyitsakor Aktv kdlap: %u 00000U\_n00000 000L0wY0N0~0Y0! 000 00000O0h0M0k0000L0zvuW0~0W0_00 s(Wn0000 000: %u 1Linia poleceD zbyt dBuga po rozszerzeniu aliasa! (BBd podczas otwierania pliku wsadowego Aktywna strona kodowa nr: %u B><0=4=0O AB@>:0 A;8H:>< 4;8==0O ?>A;5 @0725@BK20=8O ?A524>=8<>2! !H81:0 >B:@KB8O :><0=4=>3> D09;0 "5:CI0O :>4>20O AB@0=8F0: %u -Command line too long after alias expansion! Error opening batch file Active code page: %u 7Baris perintah terlalu panjang setelah ekspansi alias! Kesalaham membuka file batch Halaman kode aktif: %u -Command line too long after alias expansion! Error opening batch file Active code page: %u Ungltige Code-Page 1Ungltige Option. Erwartetes Format: /C[:]options.Ungltige Option. Erwartetes Format: /T[:]c,nnUngltige Option: %s@Die Eingaben konnten nicht umgeleitet werden (von der Datei) %s MEin Fehler ist beim Erstellen der temporren Datei fr Pipedaten aufgetreten .%s kann nicht in die Datei umgeleitet werden Ausfhrend %s... Ausfhrend cmdexit.bat... EFehler: Hinter- und Vordergrund knnen nicht die selben Farben haben!Fehler in der Farb-Angabe Farbe %x Fehler: Die selben Farben!Unbekannter Fehler: %d 0Fehler: Quelle kann nicht geffnet werden - %s! Cdigo de pgina invlido 5Opcin invlida. Se esperaba el formato: /C[:]options2Opcin invlida. Se esperaba el formato: /T[:]c,nnOpcin ilegal: %s0No se puede redirigir la entrada del archivo %s 5Error creando archivo temporal para la pila de datos $No se puede redirigir el archivo %s Ejecutando %s... Ejecutando cmdexit.bat... GMismos colores! (El color de frente y de fondo no pueden ser el mismo)$Error en la especificacin del color Color %x Error: mismos colores!Error desconocido: %d )Error: No se puede abrir el origen - %s! Page de codes invalide .Option invalide. Format attendu : /C[:]options+Option invalide. Format attendu : /T[:]c,nnOption invalide : %s0Ne peut rediriger l'entre depuis le fichier %s DErreur la cration du fichier temporaire pour les donnes du pipe %Ne peut rediriger vers le fichier %s Lance %s... Lance cmdexit.bat... AL'arrire plan et l'avant plan ne peuvent tre de la mme couleur)Erreur dans la spcification des couleurs Couleur %x Erreur : mme couleur!Erreur inconnue : %d )Erreur : Ne peut ouvrir la source - %s ! Tabella dei codici non valida 0Opzione non valida. Formato atteso: /C[:]opzioni-Opzione non valida. Formato atteso: /T[:]c,nnOpzione non valida: %s#Impossibile ridirigere dal file %s >Errore nella creazione del file temporaneo per la ridirezione #Impossibile ridirigere nel file %s Esecuzione di %s... Esecuzione di cmdexit.bat... ;Il colore di primo piano e sfondo non possono essere uguali#errore nella indicazione dei colori Colore %x #i colori non possono essere uguali!errore sconosciuto: %d 2Errore: Impossibile aprire il file sorgente - %s! Ugyldig tegntabell *Ugyldig valg. Forventet format: /C[:]valg*Ugyldig valg. Forventet format: /T[:]c,nnUlovlig operasjon: %s'Kan ikke viderefre inndata fra fil %s 4Feil under oppretting av temporr fil for datakanal Kan ikke viderefre til fil %s Kjrer %s... Kjrer cmdexit.bat... @Samme farge feil! (Bakgrunn og forgrunn kan ikke ha samme farge)feil i farge spesifikasjon Farge %x samme farge feil!Ukjent feil: %d !Feil: kan ikke pne kilden - %s! Invalid code page 0  . Expected format: /C[:]options-  . Expected format: /T[:]c,nnIllegal Option: %s"Can't redirect input from file %s ,Error creating temporary file for pipe data Can't redirect to file %s   %s... Running cmdexit.bat... FSame colors error! (Background and foreground can't be the same color)error in color specification Color %x same colors error! : %d 3:        - %s! Invalid code page -Invalid option. Expected format: /C[:]options*Invalid option. Expected format: /T[:]c,nnIllegal Option: %s"Can't redirect input from file %s ,Error creating temporary file for pipe data Can't redirect to file %s Running %s... Running cmdexit.bat... FSame colors error! (Background and foreground can't be the same color)error in color specification Color %x same colors error!Unknown error: %d Error: Cannot open source - %s! rvnytelen kdlap Arvnytelen paramter. Vrt formtum: /C[:]vlasztsi lehetQsgek/rvnytelen paramter. Vrt formtum: /T[:]v,nnrvnytelen paramter: %s6Nem lehet tirnytani a bevitelt a(z) %s llomnybl @Hiba a csQvezetkhez tartoz ideiglenes llomny ltrehozsakor *Nem lehet a(z) %s llomnyba tirnytani %s futtatsa... cmdexit.bat futtatsa... FUgyanaz a szn nem lehet! (Az elQ- s httrszn nem lehet ugyanolyan)Hibs szn megadsSzn %x Ugyanaz a szn nem lehet!Ismeretlen hiba: %d &Hiba: a forrs nem nyithat meg - %s! !qRj0000 000g0Y0 !qRj000000g0Y00g_U000f_: /C[:]00000!qRj000000g0Y00g_U000f_: /T[:]c,nn!qRj000000g0Y0: %s0000 %s K00000000eQRg0M0~0[000 $0000000Y00_00n0NBf0000\Obn0h0M0k0000L0zvuW0~0W0_00 0000 %s x0h0000000g0M0~0[000 %s 0[LW0f0D0~0Y0... cmdexit.bat 0[LW0f0D0~0Y0... +000! TX0rL0c[U00~0W0_00 (MRofrh0̀ofr0 TX0rk0Y00S0h0o0g0M0~0[00) rn0c[k0OULL0B00~0Y00 Color %x 000! TX0rL0c[U00~0W0_00 Nfj0000: %d 000: CQn00000 %s 0Q0~0[00! !NiewBa[ciwy numer strony kodowej 0Parametr niepoprawny. Poprawna forma: /C[:]opcja/Parametr niepoprawny. Poprawna forma: /T[:]c,nnZBy parametr: %s)Nie mo|na przekierowa danych z pliku %s 5BBd podczas tworzenia potokowego pliku tymczasowego #Nie mo|na przekierowa do pliku %s Wykonywanie %s... Wykonywanie cmdexit.bat... .BBd! Kolor tBa i tekstu nie mo|e by taki samBBd w oznaczeniu kolorw. Kolor %x BBd - kolory takie same!Nieznany bBd: %d &BBd: Nie mo|na otworzy zrdBa - %s! H81>G=0O :>4>20O AB@0=8F0 4H81>G=K9 ?0@0<5B@. 68405BAO D>@<0B: /C[:]?0@0<5B@K/H81>G=K9 ?0@0<5B@. 68405BAO D>@<0B: /T[:]c,nnH81>G=K9 ?0@0<5B@: %s'5 <>3C ?5@5=0?@028BL 22>4 87 D09;0 %s 1H81:0 A>740=8O 2@5<5==>3> D09;0 4;O pipe-40==KE 5 <>3C ?5@5=0?@028BL 2 D09; %s 0?CA: %s... 0?CA: cmdexit.bat... A48=0:>2K5 F25B0! (&25B0 D>=0 8 B5:AB0 =5 <>3CB 1KBL >48=0:>2K<8)>H81:0 2 C:070=88 F25B0&25B %x 48=0:>2K5 F25B0!58725AB=0O >H81:0: %d *H81:0: 52>7<>6=> >B:@KBL 8AB>G=8: - %s! Invalid code page -Invalid option. Expected format: /C[:]options*Invalid option. Expected format: /T[:]c,nnIllegal Option: %s"Can't redirect input from file %s ,Error creating temporary file for pipe data Can't redirect to file %s Running %s... Running cmdexit.bat... FSame colors error! (Background and foreground can't be the same color)error in color specification Color %x same colors error!Neznma chyba: %d Chyba: Cannot open source - %s! Halaman kode tidak benar 1Opsi tidak benar. Format diharapkan: /C[:]options.Opsi tidak benar. Format diharapkan: /T[:]c,nnOpsi tidak benar: %s*Tidak bisa mengalihkan input dari file %s 1Kesalahan membuat file termporal untuk pipe data "Tidak bisa mengalihkan ke file %s Menjalankan %s... Menjalankan cmdexit.bat... KWarna sama salah! (Latar belakang dan latar depan tidak bisa berwarna sama)!Kesalahan dalam spesifikasi warna Warna %x warna sama salah!Kesalahan tidak dikenal: %d (Salah: Tidak dapat membuka sumber - %s! Invalid code page -Invalid option. Expected format: /C[:]options*Invalid option. Expected format: /T[:]c,nnIllegal Option: %s"Can't redirect input from file %s ,Error creating temporary file for pipe data Can't redirect to file %s Running %s... Running cmdexit.bat... FSame colors error! (Background and foreground can't be the same color)error in color specification Color %x same colors error!Unknown error: %d Error: Cannot open source - %s! 4Fehler: Kann nicht ber sich selbst kopiert werden. Fehler: Schreibziel! "Fehler: Noch nicht implementiert! Ungltiges Datum.Die Datei %s wird gelscht! Sind Sie sicher (J/N)? Lschen: %s (Unbekannter Fehler! Fehlernummer: 0x%lx Syntax-Fehler'in' fehlt fr ein Statement.Klammern nicht gefunden.+Error: No se puede copiar sobre si mismo! Error escribiendo destino! Error: No implementado an! Fecha incorrecta. El archivo %s va a ser borrado!Ests seguro (S/N)? Borrando: %s +Error desconocido! Cdige de error: 0x%lx Error de sintaxsisFalta 'in' para la declaracin.!No se encontraron las parnteris.2Erreur : Ne peut copier le fichier sur lui-mme ! (Erreur l'criture de la destination ! 'Erreur : Non implment actuellement ! Date invalide.Le fichier %s va tre effac ! Etes vous sr (O/N) ? Efface : %s 'Erreur inconnue! Code d'erreur : 0x%lx Erreur de syntaxe'in' manquant.pas de parenthse trouve.2Errore: Impossibile copiare un file su se stesso! 0Errore durante la scrittura della destinazione! !Errore: Non ancora implementato! Data non valida.Il file %s sar cancellato! Sei sicuro (S/N)?Cancellazione di: %s )Errore sconosciuto! Codice errore: 0x%lx Errore di sintassi#'in' mancante nella istruzione for.Parentesi mancanti.%Feil: kan ikke kopiere til seg selv! #Feil ved skriving til destinasjon! Feil: Ikke implementert enda! Ugyldig dato.Filen %s vil bli slettet! Er du sikker (J/N)? Sletter: %s Ukjent feil! Feilkode: 0x%lx Syntaks feil'in' tapt i FOR kommando.ingen brakett funnet. : Can't copy onto itself! : writing destination! : Not implemented yet!   .%  %s   !   (Y/N)? : %s & !  : 0x%lx  'in' missing in for statement.no brackets found.Error: Can't copy onto itself! Error writing destination! Error: Not implemented yet! Invalid date.The file %s will be deleted! Are you sure (Y/N)? Deleting: %s !Unknown error! Error code: 0x%lx Syntax error'in' missing in for statement.no brackets found.,Hiba: nem msolhatod nmagra az llomnyt! Hiba a cl rsa kzben! Hiba: ez mg nem mqkdik! rvnytelen dtum.A(z) %s llomny trlve lesz! Biztos vagy benne (I/N)? Trls: %s !Ismeretlen hiba! Hiba kd: 0x%lx Szintaxis hiba!az 'in' utn hinyzik a felttel.nincs zrjel megadva.000: 000CQh0000HQL0N}g0Y0! c[HQx0n0fM00g0000L0zvuW0~0W0_0! 000: ~0`0[ňU00f0D0~0[00! !qRj0eNg0Y000000 %s o0JRdU00~0Y0! 00W0D0g0Y0K0 (Y/N)? JRdW0f0D0~0Y0: %s  Nfj0000g0Y0! 000 000: 0x%lx ie000}TNe-Nk0 'in' L0 NW0f0D0~0Y00 b'_L0d0K00~0[0004BBd: Nie mo|na przekopiowa pliku na niego samego! "BBd zapisu na miejscu docelowym! BBd: Nie zaimplementowano! Data nieprawidBowa.Plik %s zostanie skasowany! Czy jeste[ pewien (T/N)?Kasowanie: %s Nieznany bBd! Kod bBdu: 0x%lx BBd skBadniBrak 'in' dla twierdzenia.Nawias nie zostaB znaleziony.&H81:0: 52>7<>6=> :>?8@>20BL 2 A51O! H81:0 70?8A8! (H81:0:  40==K9 <><5=B =5 @50;87>20=>! 5?@028;L=0O 40B0.$09; %s 1C45B C40;5=! K C25@5=K (Y/N)? #40;5=85: %s &58725AB=0O >H81:0! >4 >H81:8: 0x%lx !8=B0:A8G5A:0O >H81:0'in' >BACBAB2C5B 2 :><0=45 for.A:>1>: =5>1=0@C65=>.Chyba: Can't copy onto itself! Error writing destination! Chyba: Zatia> neimplementovan! Neplatn dtum.The file %s will be deleted! Are you sure (Y/N)? Deleting: %s !Unknown error! Error code: 0x%lx Syntax error'in' missing in for statement.no brackets found.0Salah: Tidak dapat mengcopy ke dirinya sendiri! Kesalahan menulis tujuan! Salah: Belum diimplementasikan! Tanggal tidak benar.File %s akan dihapus! Anda yakin (Y/N)?Menghapus: %s /Kesalahan tidak dikenal! Kode kesalahan: 0x%lx Sintaks salah!'in' kurang dalam pernyataan for.tidak ada kurung ditemukan.Error: Can't copy onto itself! Error writing destination! Error: Not implemented yet! Invalid date.The file %s will be deleted! Are you sure (Y/N)? Deleting: %s !Unknown error! Error code: 0x%lx Syntax error'in' missing in for statement.no brackets found. 'do' fehlt.kein Befehl nach 'do'.Ungltiges Laufwerkkeine Bezeichnung"Keine Sprungmarke fr GOTO gesetzt&Sprungmarke '%s' wurde nicht gefunden [OK] [FEHLER] CMD: Nicht in environment '%s' +MoveFile() ist fehlgeschlagen. Fehler: %lu Derzeit noch kein Batch Support!Ungltige Zeit.Ungltige Option '/%s' Fenster nicht gefundenUngltiger Parameter - %s Falta 'do'.No hay comando despus de 'do'.Unidad errnea. Sin etiqueta#No se especifico etiqueta para GOTO!La etiqueta '%s' no se encuentra [OK] [Error] CMD: No est en el entorno '%s' MoveFile() fall. Error: %lu 8No hay soporte para archivos por lotes en este momento!Hora incorrecta.Opcin incorrecta '/%s' Ventana no encontradaInvalid switch - %s 'do' manquant.pas de commande aprs 'do'.Lecteur invalidesans nomPas de label indiqu pour GOTOLabel '%s' non trouv [OK] [Erreur] $CMD : Pas dans l'environnement '%s' "MoveFile() a chou. Erreur : %lu %Pas de support batch pour l'instant !Heure invalide.Option invalide '/%s' Fentre non trouveCommutateur invalide - %s 'do' mancante.nessuno comando dopo 'do'.Disco non validonon etichettato#Nessuna etichetta indicata per GOTOEtichetta '%s' non trovata [OK] [Errore] CMD: Non nell'ambiente '%s' MoveFile() fallita. Errore: %lu $Nessun supporto ai batch al momento!Ora non valida.Opzione '/%s' non valida finestra non trovataParametro non valido - %s 'gjre' tapt.ingen kommando etter 'gjre'.Ugyldig driverutmerket!Ingen merke spesifisert for GTILmerke '%s' ikke funnet [OK] [Feil] CMD: Ikke i miljet '%s' MoveFile() mislykkes. Feil: %lu $Ingen satsvis sttte for yeblikket! Ugyldig tid.Ugyldig alternativ '/%s' vinduet ble ikke funnetInvalid switch - %s 'do' .    'do'.   unlabeledNo label specified for GOTOLabel '%s' not found [OK] [] CMD: Not in environment '%s' MoveFile() failed. Error: %lu No batch support at the moment!  .   '/%s'    Invalid switch - %s 'do' missing.no command after 'do'. Invalid drive unlabeledNo label specified for GOTOLabel '%s' not found [OK] [Error] CMD: Not in environment '%s' MoveFile() failed. Error: %lu No batch support at the moment! Invalid time.Invalid option '/%s' window not foundInvalid switch - %s a 'do' hinyzik.nincs parancs a 'do' utn.rvnytelen meghajtnincs cimkzve#Nem lett cimke megadva a GOTO utnA '%s' cimke nem tallhat [OK] [HIBA] CMD: Not in environment '%s' %Movellomny() sikertelen. Hiba: %lu Nincs batch tmogats jelenleg!rvnytelen idQ.rvnytelen bellts '/%s' Az ablak nem tallhat'do' L0 NW0f0D0~0Y00'do' n0_k00000L0B00~0[000 !qRj00000g0Y00 000L0B00~0[000GOTO k0000L0c[U00f0D0~0[000000 '%s' L0d0K00~0[00g0W0_00 [OK] [000] CMD: Not in environment '%s' MoveFile() failed. 000: %lu sBfpg0o0000o00000U00f0D0~0[00!!qRj0Bf;Rg0Y00'/%s' o0!qRj000000g0Y0 00000L0d0K00~0[000Invalid switch - %s Brakuje 'do'.Brak komendy po 'do'.NieprawidBowa litera napdubrakBrak etykiety dla GOTO%Etykieta '%s' nie zostaBa znaleziona [OK] [BBd] CMD: Poza [rodowiskiem '%s' MoveFile() nieudane. BBd: %lu 6Programy wsadowe nie zostaBy jeszcze zaimplementowane!NieprawidBowy czas.NieprawidBowa opcja '/%s' Okno nie zostaBo odnalezione'do' >BACBA2C5B.=5B :><0=4K ?>A;5 'do'.5?@028;L=>5 8<O 48A:0 =5>B<5G5=>5 >?@545;5=0 <5B:0 4;O GOTO5B:0 '%s' =5 =0945=0 [OK] [H81:0] CMD: 5 2 A@545 >:@C65=8O '%s' 3K?>;=5=85 MoveFile() 1K;> =5CA?5H=K<. H81:0: %lu /0 40==K9 <><5=B =5B ?>445@6:8 ?0:5B=KE D09;>2!5?@028;L=>5 2@5<O.5?@028;L=K9 ?0@0<5B@ '/%s' >:=> =5 =0945=> 'do' missing.no command after 'do'. Invalid drive unlabeledNo label specified for GOTOLabel '%s' not found [OK] [Chyba] CMD: Not in environment '%s' MoveFile() failed. Error: %lu No batch support at the moment! Neplatn as.Invalid option '/%s' window not foundInvalid switch - %s 'do' hilang. tidak ada perintah setelah 'do'.Drive tidak benar tak berlabel%Tidak ada label ditetapkan untuk GOTOLabel '%s' tidak ditemukan [OK] [Salah] !CMD: Tidak dalam lingkungan '%s' !MoveFile() gagal. Kesalahan: %lu (Tidak ada dukungan batch untuk saat ini!Jam tidak benar.Opsi tidak benar '/%s' jendela tidak ditemukan 'do' missing.no command after 'do'. Invalid drive unlabeledNo label specified for GOTOLabel '%s' not found [OK] [Error] CMD: Not in environment '%s' MoveFile() failed. Error: %lu No batch support at the moment! Invalid time.Invalid option '/%s' window not foundInvalid switch - %s Pfad wurde nicht gefunden - %s PDer Dateiname, Ordnername oder die Syntax der Volumenbezeichung sind inkorrekt. Ungltige Parameterkombination Zugriff verweigert - %s Keine Dateien gefunden - %s Erweiterter Fehler 32 1Dateizuordnung fr Erweiterung %s nicht gefunden Path not found - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Access denied - %s No files found - %s Extended Error 32 ,File association not found for extension %s Chemin non trouv - %s QLa syntaxe du nom de fichier, du rpertoire, ou du nom de volume est incorrecte. #Combinaison de paramtres invalide Accs refus - %s Aucun fichier trouv - %s Erreur tendue 32 ,File association not found for extension %s Percorso non trovato - %s GIl nome del file, della cartella o della etichetta di volume errato. %Combinazione di parametri non valida Accesso negato - %s Nessun file trovato - %s Errore esteso 32 ,File association not found for extension %s Mappen ble ikke funnet - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Tilgang nektet - %s Ingen filer ble funnet - %s Extended Error 32 2Fil association ble ikke funnet for utvidelsen %s     - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination     - %s    - %s Extended Error 32 ,File association not found for extension %s Path not found - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Access denied - %s No files found - %s Extended Error 32 ,File association not found for extension %s Invalid option '/%s' Invalid option '/%s' ,File association not found for extension %s Path not found - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Access denied - %s No files found - %s Extended Error 32 ,File association not found for extension %s ,File association not found for extension %s ,File association not found for extension %s Path not found - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Access denied - %s No files found - %s Extended Error 32 ,File association not found for extension %s ,File association not found for extension %s Path not found - %s CThe filename, directory name, or volume label syntax is incorrect. Invalid parameter combination Access denied - %s No files found - %s Extended Error 32 ,File association not found for extension %s Zeigt Dateiattribute an oder ndert sie. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] Dateiname ... [/S [/D]] + Setzt ein Attribut - Lscht ein Attribut R Attribut fr 'schreibgeschtzte Datei' A Attribut fr 'zu archivierende Datei' S Attribut fr 'Systemdatei' H Attribut fr 'versteckte Datei' /S Verarbeitet bereinstimmende Dateien im aktuellen Ordner und in allen Unterordnern. /D Verarbeitet auch die Ordner. ATTRIB ohne Parameter zeigt die derzeit gesetzten Attribute aller Dateien an.+Setzt, lscht oder zeigt Alias. ALIAS [alias=[command]] alias Name des Alias. command Text welcher fr den Alias zugeordnet wird. Listet alle Aliase auf: ALIAS Setzt ein neues oder berschreibt ein bestehendes Alias: ALIAS da=dir a: Lscht ein Alias von der Alias-Liste: ALIAS da=3Gibt einen beep-Ton durch den PC-Speaker aus. BEEPRuft eine Batchdatei von einer anderen aus auf. CALL [Laufwerk:][Pfad]Dateiname [Batch-Parameter] Parameter Bezeichnet beliebige Angaben in der Befehlszeile, die von dem aufgerufenen Batchprogramm bentigt werden.iWechselt das Verzeichnis oder zeigt dessen Namen an. CHDIR [Laufwerk:][Pfad] CHDIR[..|.] CD [Laufwerk:][Pfad] CD[..|.] .. bergeordnetes Verzeichnis . vorhergehende Verzeichnis Geben Sie CD Laufwerk: ein, um das aktuelle Verzeichnis auf dem angegebenen Laufwerk anzuzeigen. Mit CD ohne Parameter wird das aktuelle Laufwerk und Verzeichnis angezeigt.Zeigt die aktuelle Codepage oder wechselt sie. CHCP [nnn] nnn Codepage angeben. Der Befehl CHCP ohne Parameter zeigt die Nummer der aktuellen Codepage an.Wartet auf den Benutzer, welcher aus einer Auswahl eine Option whlen muss. CHOICE [/C[:]choices][/N][/S][/T[:]c,nn][text] /C[:]choices Die erlaubten Tasten festlegen. Standard-Tasten sind Y und N. /N Zeigt choices und ? am ende des Promt-Strings NICHT an. /S Gro- und Kleinschreibung wird beachtet. /T[:]c,nn Standard-Auswahl wird auf c gesetzt nach nn Sekunden. text Zeigt eine Beschreibung an. ERRORLEVEL wird auf den Offset der Taste welche der Benutzer gedrckt hat gesetzt.!Lscht den Bildschirminhalt. CLSMuestra o cambia los atributos de los archivos. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Aade un atributo - Borra un atributo R Atributo de slo lectura A Atributo de archivo S Atributo de archivo de sistema H Atributo de archivo oculto /S Procesa los archivos coincidentes en el directorio actual y sus subdirectorios /D Procesa tambin los directorios Type ATTRIB without a parameter to display the attributes of all files. 1Pone, borra o muestra los alias. ALIAS [alias=[command]] alias Nombre para un alias. command Texto a ser sustituido por el alias. Para mostrar todos los alias: ALIAS Para poner un nuevo o remplazar un alias existente: ALIAS da=dir a: Para borrar un alias de la lista de alias: ALIAS da=&Emite un pitido por el altavoz. BEEP Ejecuta un arhivo por lotes desde otro archivo por lotes. CALL [drive:][path]filename [batch-parameter] batch-parameter Especifica cualquier informacion de la linea de comandos requerida por el archivo por lotes.|Cambia el directorio actual o muestra su nombre. CHDIR [/D][drive:][path] CHDIR[..|.] CD [/D][drive:][path] CD[..|.] .. Directorio padre. . Directorio actual. /D Cambiara la unidad y el directorio actual. Escribe CD unidad: para mostrar el directorio actual en la unidad especificada. Escribe CD sin ningun parmetro para mostrar la unidad y el directorio actual. Muestra o configura el nmero de pgina de cdigo activa. CHCP [nnn] nnn Especifica el nmero de pgina de cdigo activa. Escribe CHCP sin ningn parmetro para mostrar el cdigo de pgina activo. Espera a que el usuario elija entre un nmero de opciones. CHOICE [/C[:]choices][/N][/S][/T[:]c,nn][text] /C[:]choices Especifica las teclas admitidas. Por defecto son SN. /N No muestra las posibles elecciones y ? al final del prompt. /S Hace que la eleccin sea sensible a las maysculas y minsculas. /T[:]c,nn La eleccin por defecto ser c despus de nn segundos. text Prompt a mostrar. ERRORLEVEL se configura al offset de la tecla que presione el usuario. Limpia la pantalla. CLS Affiche ou change des attributs de fichiers. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Positionne un attribut - Enlve un attribut R Fichier en lecture seule A Fichier archive S Fichier systme H Fichier cach /S Traite les fichiers correspondants dans le rpertoire courant et tous les sous-rpertoires /D Traite galement les rpertoires Taper ATTRIB sans paramtre pour afficher les attributs de tous les fichiers.)Positionne, enlve ou affiche les alias. ALIAS [alias=[commande]] alias Nom de l'alias. commande Texte substituer l'alias. Pour afficher tous les alias: ALIAS Pour crer ou remplacer un alias existant: ALIAS da=dir a: Pour effacer un alias de la liste des alias : ALIAS da=.met un bip par le haut-parleur systme. BEEPAppelle un programme batch depuis un autre. CALL [lecteur:][chemin]fichier [paramtre-batch] paramtre-batch Spcifie les paramtres ncessaires au programme batch.}Change ou affiche le rpertoire courant CHDIR [lecteur:][chemin] CHDIR[..|-] CD [lecteur:][chemin] CD[..|-] .. rpertoire parent - rpertoire prcdent /D Changera le lecteur et le rpertoire courant. Taper CD lecteur: pour afficher le rpertoire courant sur le disque indiqu. Taper CD sans paramtre pour afficher le rpertoire courant du disque actuel. Affiche ou change la page de codes active. CHCP [nnn] nnn Indique la page de codes . Taper CHCP sans paramtre pour afficher la page de codes active.2Demande l'utilisateur de choisir parmi plusieurs choix. CHOICE [/C[:]choix][/N][/S][/T[:]c,nn][texte] /C[:]choix Spcifier les touches disponibles. Choix par dfaut: ON. /N Ne pas afficher les choix disponibles et ? la fin du texte d'invite. /S Traiter les touches comme diffrentes si ce sont des majuscules ou minuscules. /T[:]c,nn Choix par dfaut aprs nn secondes. texte Texte d'invite afficher. ERRORLEVEL est modifi l'offset de la touche enfonce parmi les choix.Efface l'cran. CLSVisualizza o modifica gli attributi dei file. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Attiva un attributo - Toglie un attributo R Attributo di file di sola lettura A Attributo di file di archivio S Attributo di file di sistema H Attributo di file nascosto /S Tratta i file indicati nella cartella corrente e in tutte le sottocartelle /D Tratta anche le cartelle Scrivi ATTRIB senza parametri per visualizzare gli attributi di tutti i file. Attiva, toglie o visualizza gli alias. ALIAS [alias=[comando]] alias Nome dell'alias. comando Testo che corrisponde all'alias. Per visualizzare tutti gli alias: ALIAS Per attivarne uno nuovo o sostituire uno esistente: ALIAS da=dir a: Per rimuovere un alias: ALIAS da= Segnale acustico. BEEP Chiama un programma batch da un altro. CALL [disco:][percorso]nomefile [Parametri] Parametri Indicano le informazioni richieste per il programma batch.uCambia la cartella corrente o ne visualizza nome CHDIR [/D][disco:][percorso] CHDIR[..|.] CD [/D][disco:][percorso] CD[..|.] .. cartella padre . cartella corrente /D Cambia il disco e la cartella corrente. Scrivi CD disco: per visualizzare la cartella corrente del disco indicato. Scrivi CD senza parametri per visualizzare il disco e la cartella corrente. Visualizza o attiva il numero di tabella dei codici. CHCP [nnn] nnn Indica il numero di tabella dei codici. Scrivi CHCP senza parametri per visualizzare il numero attuale. Aspetta che l'utente scelga una delle scelte disponibili. CHOICE [/C[:]scelta][/N][/S][/T[:]c,nn][testo] /C[:]scelta Indica i tasti ammessi. Sono predefiniti YN. /N Non visualizza le scelte e ? alla fine del messaggio di richiesta. /S Considera i tasti di scelta come sensibili al case. /T[:]s,nn Scelta predefinita a S dopo nn secondi. testo Messaggio di richiesta da visualizzare. ERRORLEVEL valorizzato alla posizione in elenco delle scelta dell'utente. Cancella lo schermo. CLS Viser eller endrer filattributtene. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] fil ... [/S [/D]] + Setter et attributt - Fjerner et attributt R Attributt: Skrivebeskyttet. A Attributt: Arkiver. S Attributt: System. H Attributt: Skjult. /S Behandler tilsvarende filer i gjeldende mappe og alle undermapper. /D Bearbeider ogs mapper. Skriv ATTRIB uten parametere for vise attributtene til alle filer. -Setter, fjerner eller viser alias. ALIAS [alias=[Kommando]] alias Navn for et alias. Kommando Tekst som skal erstattes av et alias. for liste alle alias: ALIAS For sette en ny eller endre et eksisterende alias: ALIAS da=dir a: For fjerne et alias fra alias-liste: kortnavn da=$Gir lydsignal til hyttaleren. PIP Kaller et satsvis program fra et annet. CALL [stasjon:][mappe]filnavn [satsvis-parameter] satsvis-parameter Spesifisere noen kommando-linje informasjon trengs av satsvis program.eViser navnet p, eller endrer gjeldende mappe CHDIR [/D][stasjon:][mappe] CHDIR[..|.] CD [/D][stasjon:][mappe] CD[..|.] .. overordnet mappe . gjeldende mappe /D Vil endre gjeldende stasjon og gjeldende mappe. Tast CD stasjon: for vise gjeldende mappe p spesifiserte stasjon. Tast CD uten parametere for vise gjeldende stasjon og mappe. Viser eller velger aktive tegntabellnummer. CHCP [nnn] nnn Spesifisere aktive tegntabellnummer. Skriv CHCP uten parametrer for vise aktiv tegntabellnummer. Venter p at bruker skal velge ett av alternativene. CHOICE [/C[:]valg][/N][/S][/T[:]c,nn][tekst] /C[:]Valg Spesifisere tillatte nkler. Standard er JN. /N Ikke vis valgene og ? ved enden av sprsml. /S Behandle valgte nkkel som flsom for store/sm bokstaver. /T[:]c,nn Standard valg settes til c etter nn sekunder. tekst Tekststreng som vises. ERRORLEVEL settes til nummer for knappen brukeren velger. Tmmer skjermen. CLS X      . ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] +   . -   . R     . A   . S   . H   . /S             . /D   .  ATTRIB  ,        . F,    aliases. ALIAS [alias=[]] alias    alias. command       alias.      aliases: ALIAS           alias: ALIAS da=dir a:     alias   : ALIAS da=Beep the speaker. BEEP Calls one batch program from another. CALL [drive:][path]filename [batch-parameter] batch-parameter Specifies any command-line information required by the batch program.     . CHDIR [/D][:][] CHDIR[..|.] CD [/D][:][] CD[..|.] ..   .   /D              .  CD :,          .  CD  ,          .        . CHCP [nnn] nnn    .  CHCP  ,       .          . CHOICE [/C[:]][/N][/S][/T[:]c,nn][] /C[:]   .     YN. /N      ?     . /S        . /T[:]c,nn    c   nn .     . ERRORLEVEL is set to offset of key user presses in choices.   . CLS Displays or changes file attributes. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Sets an attribute - Clears an attribute R Read-only file attribute A Archive file attribute S System file attribute H Hidden file attribute /S Processes matching files in the current directory and all subdirectories /D Processes directories as well Type ATTRIB without a parameter to display the attributes of all files. Sets, removes or shows aliases. ALIAS [alias=[command]] alias Name for an alias. command Text to be substituted for an alias. To list all aliases: ALIAS To set a new or replace an existing alias: ALIAS da=dir a: To remove an alias from the alias list: ALIAS da=Beep the speaker. BEEP Calls one batch program from another. CALL [drive:][path]filename [batch-parameter] batch-parameter Specifies any command-line information required by the batch program.tChanges the current directory or displays it's name CHDIR [/D][drive:][path] CHDIR[..|.] CD [/D][drive:][path] CD[..|.] .. parent directory . current directory /D Will change current drive and current directory. Type CD drive: to display the current directory on the specified drive. Type CD without a parameter to display the current drive and directory. Displays or sets the active code page number. CHCP [nnn] nnn Specifies the active code page number. Type CHCP without a parameter to display the active code page number. Waits for the user to choose one of a set of choices. CHOICE [/C[:]choices][/N][/S][/T[:]c,nn][text] /C[:]choices Specifies allowable keys. Default is YN. /N Do not display choices and ? at the end of the prompt string. /S Treat choice keys as case sensitive. /T[:]c,nn Default choice to c after nn seconds. text Prompt string to display. ERRORLEVEL is set to offset of key user presses in choices. Clears the screen. CLS llomnyok attribtumok megjelentse vagy belltsai. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] llomny ... [/S [/D]] + bekapcsol egy attribtumot - kikapcsol egy attribtumot R rsvdett llomny A Archivland llomny S Rendszer llomny H Rejtett llomny /S Minden llomny mdostsa a mappban s minden almappbanban /D Mappkra is rvnyesti Ha ATTRIB-ot paramter nlkl rod be, megjelenti a mappban tallhat sszes llomnyt s annak attribtumt. Aliasok megjelentse, hozzadsa s trlse ALIAS [alias=[parancs]] alias Alias neve. parancs A szveg amit behelyettest. Aliasok megjelentse: ALIAS Egy j hozzadsa vagy meglvQ helyettestlse: ALIAS da=dir a: Egy alias trlse: ALIAS da='Hangjelzs leadsa a speakerbQl. BEEP Ktegelt parancsfjl meghvsa egy msikbl. CALL [ktet:][elrsi_t]llomny [paramterek] paramterek Itt adhat meg a szksges paramterlistaAz aktulis mappa nevnek a megjelentse vagy vlts msikra CHDIR [/D][meghajt:][elrsi_t] CHDIR[..|.] CD [/D][meghajt:][elrsi_t] CD[..|.] .. SzlQ mappa /D Megvltoztatja az aktulis mappt s meghajtt is. rd be, hogy 'CD meghajt:' hogy ki rja az aktulis mappt. rd be a CD-t paramterek nlkl, hogy megjelentse az aktulis meghajtt s mappt (ugyanaz mint az elQzQ). Megjelenti vagy megvltoztatja az aktv kdlapot. CHCP [nnn] nnn A hasznlni kvnt kdlap szma. rd be a CHCP paramterek nlkl, hogy megjelentse az aktv kdlapot. ,Vr a felhasznlra, hogy vlasszon a felknlt lehetQsgek kzl. CHOICE [/C[:]vlasztsi lehetQsgek][/N][/S][/T[:]c,nn][szveg] /C[:]vlasztsi lehetQsgek Megengedett billentyqk. Alaprtelmezett: YN. <-- Yes->Igen /N Elrejti a vlasztsi lehetQsgeket s a krdQjelet. /S Kis- s nagybetqk megklnbztetse. /T[:]v,nn A v lehetQsget vlasztja nn msodperc utn. szveg MegjelentendQ szveg. Az ERRORLEVEL a vlasz sorszmra lesz belltva. Trli a kpernyQt. CLS 30000^\'`0h:y~0_0o0 YfW0~0Y00 ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] [0000] ... [/S [/D]] + ^\'`0-[W0~0Y00 - ^\'`0dW0~0Y00 R 0h00\(u^\'`0 A 00000^\'`0 S 0000 0000^\'`0 H W00000^\'`0 /S s(Wn00000h0Y0y0f0n0000000n0NY0000000 QtW0~0Y00 /D 00000QtW0~0Y00 000000c[W0j0D0g0 ATTRIB h0eQRY00h00Y0y0f0n00000n0^\'`0h:yW0~0Y00 00000n0-[0d0W0_000000000h:yW0_00W0~0Y00 ALIAS [00000=[0000]] 00000 00000h0W0f0d0Q00 TMR0 0000 00000h0W0f0-[Y00eW[R0 Y0y0f0n0000000Nh:yY00k0o0: ALIAS e_0k0000000-[W0_000eX[n0000000nM0cH00k0o0: ALIAS da=dir a: 00000n0000K00000000S0dO0k0o0: ALIAS da=0000K0000000W0~0Y00 BEEP 000 000000%Rn0000 00000K00|Ts0QW0~0Y00 CALL [0000:][00]0000 T [00000000] 00000000 000 00000g0_j00000 000`1X0 c[W0~0Y00s(Wn00000000 YfW0_000000000 T0h:yW0_00W0~0Y00 CHDIR [/D][0000:][00] CHDIR[..|.] CD [/D][0000:]00] CD[..|.] .. 000000 . s(Wn0000000 /D s(Wn00000h0000000n0!Ne0 YfW0~0Y00 CD 0000: h0eQRY00h0c[U00_00000n0s(Wn0000000L0h:yU00~0Y00 000000c[W0j0D0g0 CD h0eQRY00h00s(Wn00000h0000000L0h:yU00~0Y00 qs(Wn0000 000juS0h:y~0_0o0-[W0~0Y00 CHCP [nnn] nnn 000 000juS0c[W0~0Y00 s(Wn0000 000juS0h:yY00h0M0o00000000c[[0Z0k0 CHCP h0eQRW0f0O0`0U0D00 90000L0xbK00Nd00xbY00n00_a0~0Y00 CHOICE [/C[:]xb][/N][/S][/T[:]c,nn][eW[R] /C[:]xb 1U00000eQR0c[W0~0Y0000000o0 YN g0Y00 /N 00000n0eW[Rn0g_k00xbh0 ? 0h:yW0~0[000 /S 00eQRn0'YeW[0\eW[0:S%RW0~0Y00 /T[:]c,nn nn yL}NY00h0Rvk0 c 0xbW0~0Y00 eW[R h:yY0000000n0eW[Rg0Y00 0000L0xbk0B00000bY0h00]0n000000L0 ERRORLEVEL k0000U00~0Y00 ;ub0mSW0~0Y00 CLS Wy[wietla lub zmienia atrybuty plikw. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] nazwa_pliku ... [/S [/D]] + Ustawia atrybut - Czy[ci atrybut R Atrybut pliku tylko do odczytu A Atrybut pliku archiwalnego S Atrybut pliku systemowego H Atrybut pliku ukrytego /S Przetwarza wszystkie, pasujce pliki w bie|cym katalogu i we wszystkich podkatalogach /D Przetwarza rwnie| katalogi Wpisz ATTRIB bez |adnego parametru, by wy[wietli atrybuty wszystkich plikw. .Ustawia, usuwa, a tak|e wy[wietla aliasy. ALIAS [nazwa=[tekst]] nazwa Nazwa aliasu. tekst Cig tekstu, jaki ma zosta zastpiony aliasem. Aby wy[wietli wszystkie aliasy: ALIAS Aby ustawi nowy albo zmieni ju| istniejcy alias: ALIAS da=dir a: Aby usun istniejcy alias: ALIAS da=)SygnaB dzwikowy z gBo[nika PC. BIIIIIP Umo|liwia wywoBanie programu wsadowego z poziomu innego. CALL [napd:][[cie|ka]nazwa_pliku [parametry] parametry Wszelkie dane, wymagane przez program wsadowy, ktry ma zosta wywoBany.eZmienia obecny katalog albo wy[wietla jego peBn nazw. CHDIR [/D][napd:][[cie|ka] CHDIR[..|.] CD [/D][napd:][[cie|ka] CD[..|.] .. katalog poziom wy|ej . bie|cy katalog /D Umo|liwia zmian napdu. Wpisz CD [napd:], by wy[wietli bie|cy katalog na danym napdzie. Wpisz CD bez |adnych parametrw, by wy[wietli bie|cy napd i katalog. Wy[wietla lub ustawia numer aktywnej strony kodowej. CHCP [nnn] nnn Numer strony kodowej. Wpisz CHCP bez parametru, by wy[wietli numer aktywnej strony kodowej. -Wy[wietla opcje jakimi dysponuje u|ytkownik i oczekuje na wybr jednej z nich. CHOICE [/C[:]opcje][/N][/S][/T[:]c,nn][tekst] /C[:]opcje Wyznacza klawisze wy[wietlane jako wybr. Domy[lne: TN. /N Nie wy[wietla klawiszy opcji ani znaku ? na koDcu tekstu. /S Komenda wyr|ni wielko[ liter przy wpisywaniu (n != N). /T[:]c,nn Komenda zwrci domy[lny klawisz (c) po upBywie (nn) sekund . tekst Tekst wy[wietlany przy oczekiwaniu na wybr. ERRORLEVEL ustawiony jest na kompensowanie wyboru u|ytkownika domy[lnym. Czy[ci ekran konsoli. CLS K2>4 8 87<5=5=85 0B@81CB>2 D09;>2. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] D09; ... [/S [/D]] + #AB0=>2:0 0B@81CB0. - !=OB85 0B@81CB0. R B@81CB "">;L:> GB5=85". A B@81CB "@E82=K9". S B@81CB "!8AB5<=K9". H B@81CB "!:@KBK9". /S 1@01>B:0 D09;>2 A C:070==K<8 8<5=0<8 2 B5:CI59 ?0?:5 8 2> 2A5E 55 ?>4?0?:0E. /D 1@01>B:0 8 D09;>2, 8 ?0?>:. ATTRIB 157 ?0@0<5B@>2 2K2>48B 0B@81CBK 2A5E D09;>2. @K2>4, CAB0=>2:0 8;8 C40;5=85 ?A524>=8<>2. ALIAS [?A524>=8<=[:><0=40]] ?A524>=8< 08<5=>20=85 ?A524>=8<0. :><0=40 "5:AB, ?>4AB02;O5<K9 2<5AB> ?A524>=8<0. K2>4 A?8A:0 2A5E ?A524>=8<>2: ALIAS #AB0=>2:0 8;8 87<5=5=85 ACI5AB2CNI53> ?A524>=8<0: ALIAS da=dir a: #40;5=85 ?A524>=8<0 87 A?8A:0: ALIAS da=2C:>2>9 A83=0;. BEEP K7>2 >4=>3> ?0:5B=>3> D09;0 87 4@C3>3>. CALL [48A::][?CBL]8<O_D09;0 [?0@0<5B@K] ?0@0<5B@K 01>@ ?0@0<5B@>2 :><0=4=>9 AB@>:8, =5>1E>48<KE ?0:5B=><C D09;C.vK2>4 8<5=8 ;81> A<5=0 B5:CI53> :0B0;>30. CHDIR [/D][48A::][?CBL] CHDIR[..|.] CD [/D][48A::][?CBL] CD[..|.] .. >1>7=0G05B @>48B5;LA:89 :0B0;>3 . >1>7=0G05B B5:CI89 :0B0;>3 /D 4=>2@5<5==0O A<5=0 B5:CI8E 48A:0 8 :0B0;>30. ><0=40 CD 48A:: >B>1@0605B 8<O B5:CI53> :0B0;>30 C:070==>3> 48A:0. ><0=40 CD 157 ?0@0<5B@>2 >B>1@0605B 8<5=0 B5:CI8E 48A:0 8 :0B0;>30. K2>4 8;8 A<5=0 B5:CI53> =><5@0 :>4>2>9 AB@0=8FK. CHCP [nnn] nnn ><5@ :>4>2>9 AB@0=8FK. ><0=40 CHCP 157 ?0@0<5B@0 2K2>48B B5:CI89 =><5@ :>4>2>9 AB@0=8FK. 45B, ?>:0 ?>;L7>20B5;L =5 2K15@5B >48= 87 C:070==KE 2 A?8A:5 A8<2>;>2. CHOICE [/C[:]A?8A>:_A8<2>;>2][/N][/S][/T[:]c,nn][B5:AB] /C[:]A?8A>:_A8<2>;>2 #:07K205B 4>?CAB8<K5 A8<2>;K. > C<>;G0=8N MB> YN. /N 5 2K2>48BL A?8A>: A8<2>;>2 8 ? ?>A;5 ?>4A:07:8. /S "@0:B>20BL A8<2>;K :0: GC2AB28B5;L=K5 : @538AB@C. /T[:]c,nn > C<>;G0=8N 2K1>@ c ?> 8AB5G5=88 nn A5:C=4. text >4A:07:0. ERRORLEVEL CAB0=02;8205BAO @02=K< =><5@C 2K1@0==>3> A8<2>;0. G8AB:0 M:@0=0. CLS Displays or changes file attributes. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Sets an attribute - Clears an attribute R Read-only file attribute A Archive file attribute S System file attribute H Hidden file attribute /S Processes matching files in the current directory and all subdirectories /D Processes directories as well Type ATTRIB without a parameter to display the attributes of all files. Sets, removes or shows aliases. ALIAS [alias=[command]] alias Name for an alias. command Text to be substituted for an alias. To list all aliases: ALIAS To set a new or replace an existing alias: ALIAS da=dir a: To remove an alias from the alias list: ALIAS da=Ppnutie reproduktora. BEEP Calls one batch program from another. CALL [drive:][path]filename [batch-parameter] batch-parameter Specifies any command-line information required by the batch program.tChanges the current directory or displays it's name CHDIR [/D][drive:][path] CHDIR[..|.] CD [/D][drive:][path] CD[..|.] .. parent directory . current directory /D Will change current drive and current directory. Type CD drive: to display the current directory on the specified drive. Type CD without a parameter to display the current drive and directory. Displays or sets the active code page number. CHCP [nnn] nnn Specifies the active code page number. Type CHCP without a parameter to display the active code page number. Waits for the user to choose one of a set of choices. CHOICE [/C[:]choices][/N][/S][/T[:]c,nn][text] /C[:]choices Specifies allowable keys. Default is YN. /N Do not display choices and ? at the end of the prompt string. /S Treat choice keys as case sensitive. /T[:]c,nn Default choice to c after nn seconds. text Prompt string to display. ERRORLEVEL is set to offset of key user presses in choices. Vyma~e obrazovku. CLS Menampilkan atau mengubah atribut file. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] file ... [/S [/D]] + Menyetel atribut - Membersihkan atribut R Atribut file Hanya-baca A Atribut file Arsip S Atribut file Sistem H Atribut file Tersembunyi /S Proses file yang sama dalam direktori dan semua subdirektori saat ini /D Proses direktori juga Ketik ATTRIB tanpa parameter untuk menampilkan atribut dari semua file. 7Menyetel, menghapus atau menampilkan alias. ALIAS [alias=[command]] alias Nama untuk alias. command Teks yang disubstitusi untuk alias. Untuk mendaftar semua alias: ALIAS Untuk menyetel alias baru atau menimpa yang sudah ada: ALIAS da=dir a: Untuk menghapus alias dari daftar alias: ALIAS da=Bunyikan speaker. BEEP Memanggil satu program batch dari yang lainnya. CALL [drive:][path]filename [batch-parameter] batch-parameter Specifies any command-line information required by the batch program.xMengubah direktori saat ini atau menampilkan namanya CHDIR [/D][drive:][path] CHDIR[..|.] CD [/D][drive:][path] CD[..|.] .. direktori leluhurnya . direktori saat ini /D Akan mengubah drive dan direktori saat ini. Ketik CD drive: untuk menampilkan direktori saat ini pada drive tertentu. Ketik CD tanpa parameter untuk menampilkan drive dan direktori saat ini. Menampilkan atau menyetel nomor halaman kode aktif. CHCP [nnn] nnn Menetapkan nomor halaman kode yang aktif. Ketik CHCP tanpa parameter untuk menampilkan nomor halaman kode yang aktif. Menunggu pengguna untuk memilih satu dari set pilihan. CHOICE [/C[:]pilihan][/N][/S][/T[:]c,nn][text] /C[:]pilihan Menetapkan tombol yang dibolehkan. Standarnya YT. /N Jangan tampilkan pilihan dan ? di akhir prompt string. /S Perlakukan tombol pilihan sebagai sensitif huruf. /T[:]c,nn Pilihan standar untuk c setelah nn detik. text Prompt string untuk ditampilkan. ERRORLEVEL disetel ke ofset tombol yang ditekan pengguna dalam pilihan. Membersihkan layar. CLS V4>1@065==O 01> 7<V=0 0B@81CBV2 D09;C. ATTRIB [+R | -R] [+A | -A] [+S | -S] [+H | -H] D09; ... [/S [/D]] + #AB0=>2:0 0B@81CBC - =OBBO 0B@81CBC R B@81CB D09;C "8H5 G8B0==O" A B@81CB D09;C "@EV2=89" S B@81CB D09;C "!8AB5<=89" H B@81CB D09;C "@8E>20=89" /S 1@>1:0 D09;V2 7V 2:070=8<8 V<5=0<8 2 ?>B>G=V9 ?0?FV V C 2AVE WW ?V4?0?:0E /D 1@>1:0 B0:>6 V ?0?>: 254VBL ATTRIB 157 ?0@0<5B@0, I>1 2825AB8 0B@81CB8 2AVE D09;V2. AAB0=>2;5==O, 2840;5==O 01> ?>:07 ?A524>=V<V2. ALIAS [?A524>=V<=[:><0=40]] ?A524>=V< <'O ?A524>=V<0. :><0=40 "5:AB, I> ?V4AB02;OTBLAO 70<VABL ?A524>=V<0. 82545==O A?8A:C 2AVE ?A524>=V<V2: ALIAS AB0=>2;5==O 01> 7<V=0 VA=CNG>3> ?A524>=V<0: ALIAS da=dir a: 840;5==O ?A524>=V<0 7V A?8A:C: ALIAS da=2C:>289 A83=0; A?V:5@0. BEEP 8:;8: >4=VTW ?0:5B=>W ?@>3@0<8 7 V=H>W. CALL [48A::][H;OE]V<'O_D09;0 [?0@0<5B@8] ?0@0<5B@8 01V@ ?0@0<5B@V2 :><0=4=>3> @O4:0, =5>1EV4=8E 4;O ?0:5B=>3> D09;C.tChanges the current directory or displays it's name CHDIR [/D][drive:][path] CHDIR[..|.] CD [/D][drive:][path] CD[..|.] .. parent directory . current directory /D Will change current drive and current directory. Type CD drive: to display the current directory on the specified drive. Type CD without a parameter to display the current drive and directory. Displays or sets the active code page number. CHCP [nnn] nnn Specifies the active code page number. Type CHCP without a parameter to display the active code page number. Waits for the user to choose one of a set of choices. CHOICE [/C[:]choices][/N][/S][/T[:]c,nn][text] /C[:]choices Specifies allowable keys. Default is YN. /N Do not display choices and ? at the end of the prompt string. /S Treat choice keys as case sensitive. /T[:]c,nn Default choice to c after nn seconds. text Prompt string to display. ERRORLEVEL is set to offset of key user presses in choices. Clears the screen. CLS  Intere Befehle verfgbar:  Verfgbare Features: [aliases] [history] [unix filename completion] [directory stack] [redirections and piping]Startet eine neue Instanz des ReactOS-Befehlsinterpreters. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Fhrt den Befehl in der Zeichenfolge aus und schliet sich. /K command Fhrt den Befehl in der Zeichenfolge aus und luft weiter. /P CMD wird permanent und fhrt autoexec.bat aus (kann nicht beendet werden). /T:bf Setzt die Hintergrund- und Vordergrund-Farbe (siehe COLOR Befehl).Modifiziert Dateierweiterungs-Zuordnungen. assoc [.erw[=[Dateityp]]] assoc (Gibt alle Zuordnungen aus) assoc .erw (Gibt die spezifische Zuordnung aus) assoc .erw= (Lscht die spezifische Zuordnung) assoc .erw=Dateityp (Fgt neue Zuordnung hinzu) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s] Comandos internos disponibles:  Caractersticas disponibles: [alias] [historia]+ [Completador de nombres de archivos unix] [Pila de directorios] [Redirecciones y tneles]Comienza una nueva sesion del interprete de comandos de ReactOS. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Ejecuta el comando especificado y cierra. /K command Ejecuta e comando especificado y permanece. /P CMD se hace permanente y ejecuta el autoexec.bat (no puede ser cerrado). /T:bf Configura el color de fondo/primer plano (mirar el comando COLOR). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s] " Commandes internes disponibles :  Fonctions disponibles : [alias] [historique]. [compltion des noms de fichiers faon unix] [pile de rpertoires] [redirections et canaux]Dmarre une nouvelle instance de l'interprteur de commandes de ReactOS. CMD [/[C|K] commande][/P][/Q][/T:ap] /C commande Lance la commande spcifie et se termine. /K commande Lance la commande spcifie et reste en mmoire. /P CMD devient permanent et lance autoexec.bat (ne peut tre termin). /T:ap Changer la couleur d'arrire/premier plan (voir la commande COLOR.)Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  Comandi interni disponibili:  Funzioni disponibili: [alias] [storia]. [completamento automatico dei nomi dei file] [cartelle] [ridirezione e piping]Attiva un altro interprete dei comandi ReactOS. CMD [/[C|K] comando][/P][/Q][/T:bf] /C comando Esegue il comando indicato e poi termina. /K comando Esegue il comando indicato e poi rimane in esecuzione. /P CMD rimane permanente ed esegue autoexec.bat (non pu essere fermato). /T:bf Definisce i colori di primo piano e sfondo (vedi anche il comando COLOR). Modifica le associazioni per le estensioni dei file. assoc [.ext[=[FileType]]] assoc (mostra tutte le associazioni) assoc .ext (mostra una specifica associazione) assoc .ext= (rimuove una specifica associazione) assoc .ext=FileType (aggiung una associazione) Crea un oggetto di collegamento nel filesystem. MKLINK [/D | /H | /J] nomelink target /D Indica che il link simbolico riferito a una cartella. /H Crea un hard link. /J Crea una directory junction. Se non sono specificati ne /H ne /J verr creato un link simbolico.)ReactOS Operating System [Version %s-%s] " Interne kommandoer tilgjengelig:  Funksjoner tilgjengelig: [aliaser] [historikk] [unix filnavnfullfring] [mappeliste] [omadressering og datakanaler]gStart et nytt eksempel av ReactOS kommandotolk. CMD [/[C|K] kommando][/P][/Q][/T:bf] /C kommando Kjrer spesifiserte kommando og avsluttes. /K kommando Kjrer spesifiserte kommando og bestr. /P CMD kjrer permanent og starter autoexec.bat (kan ikke avsluttes). /T:bf Velg bakgrunn/forgrunn farge (se COLOR kommando). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.'ReactOS Operativsystem [Versjon %s-%s]   :   : [aliases] [] [unix filename completion] [directory stack] [redirections and piping]Starts a new instance of the ReactOS command line interpreter. CMD [/[C|K] ][/P][/Q][/T:bf] /C       . /K       . /P  CMD      autoexec.bat (   ). /T:bf    /  (  COLOR ). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  Internal commands available:  Features available: [aliases] [history] [unix filename completion] [directory stack] [redirections and piping]|Starts a new instance of the ReactOS command line interpreter. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Runs the specified command and terminates. /K command Runs the specified command and remains. /P CMD becomes permanent and runs autoexec.bat (cannot be terminated). /T:bf Sets the background/foreground color (see COLOR command). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  ElrhetQ belsQ parancsok:  ElrhetQ lehetQsgek: [aliasok] [elQzmnyek]' [unix tpus llomnynv kiegszts] [mappa tr]! [tirnytsok s csQvezetkek]:Elindt egy j ReactOS parancssor rtelmezQ. CMD [/[C|K] parancs][/P][/Q][/T:eh] /C parancs Vgrehajtja a parancsot, majd kilp. /K parancs Vgrehajtja a parancsot, s tovbb fut az rtelmezQ. /P rtelmezi az autoexec.bat llomnyt s a memriban marad. /T:eh COLOR parancs hasznlata. Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  )R(ug0M00Q萳0000: )R(ug0M00_j: [00000] [0000] [UNIX 0000 T܈[] [000000 0000] [000000h0000]-ReactOS 0000 000 0000000n0eW0D00000000YW0~0Y00 CMD [/[C|K] 0000][/P][/Q][/T:bf] /C 0000 c[U00_000000[LW0_0_0B}NW0~0Y00 /K 0000 c[U00_000000[LW0~0Y0L00B}NW0~0[000 /P CMD o08l}vk0R\O0W00autoexec.bat 0[LW0~0Y0 (B}NU0[00S0h0o0g0M0~0[00)0 /T:bf MRofrJ00s0̀ofr0-[W0~0Y0 (s0}o0 COLOR /? 0SgqW0f0 O0`0U0D0)0 Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s] Dostpne wewntrzne polecenia:  Dostpne opcje: [aliasy] [historia] [dopeBnianie nazw unixa] [stos katalogu] [przekierowania i potoki]Uruchamia nowe okno konsoli ReactOS (interpreter linii poleceD). CMD [/[C|K] komenda][/P][/Q][/T:bf] /C komenda Wykonuje podan komend i zamyka okno. /K komenda Wykonuje podan komend i pozostawia okno. /P CMD przetwarza autoexec.bat i pozostaje permanentny (okno nie mo|e zosta zamknite). /T:bf Ustawia kolor tBa/tekstu (patrz komenda COLOR). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  >ABC?=K5 2=CB@5==85 :><0=4K:  >ABC?=K5 2>7<>6=>AB8: [?A524>=8<K] [8AB>@8O] [7025@H5=85 8<5= D09;>2 unix] [AB5: 48@5:B>@89] [?5@5=0?@02;5=85 8 piping]0?CA: =>2>9 :>?88 8=B5@?@5B0B>@0 :><0=4 ReactOS. CMD [/[C|K] :><0=40][/P][/Q][/T:bf] /C :><0=40 K?>;=5=85 C:070==>9 :><0=4K A ?>A;54CNI8< 7025@H5=85<. /K :><0=40 K?>;=5=85 C:070==>9 :><0=4K 157 ?>A;54CNI53> 7025@H5=8O. /P CMD AB0=>28BAO ?5@<0=5=B=K< 8 70?CA:05B autoexec.bat (?@>F5AA =5<>65B 1KBL 7025@H5=). /T:F2 K1>@ F25B0 B5:AB0/D>=0 (1>;55 ?>4@>1=> A<. COLOR /?). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  Internal commands available:  Features available: [aliases] [history] [unix filename completion] [directory stack] [redirections and piping]|Starts a new instance of the ReactOS command line interpreter. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Runs the specified command and terminates. /K command Runs the specified command and remains. /P CMD becomes permanent and runs autoexec.bat (cannot be terminated). /T:bf Sets the background/foreground color (see COLOR command). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.'Opera n systm ReactOS [Verzia %s-%s] " Perintah internal yang tersedia:  Fitur yang tersedia: [alias] [histori] [pelengkapan nama file unix] [tumpukan direktori] [pengalihan dan piping]Memulai instan baru dari interpreter baris perintah ReactOS. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Menjalankan perintah yang ditetapkan dan mengakhiri. /K command Menjalankan perintah yang ditetapkan dan tetap tinggal. /P CMD menjadi permanen dan menjalankan autoexec.bat (tidak bisa diakhiri). /T:bf Menyetel warna latar belakang/depan (lihat perintah COLOR). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s]  Internal commands available:  Features available: [aliases] [history] [unix filename completion] [directory stack] [redirections and piping]|Starts a new instance of the ReactOS command line interpreter. CMD [/[C|K] command][/P][/Q][/T:bf] /C command Runs the specified command and terminates. /K command Runs the specified command and remains. /P CMD becomes permanent and runs autoexec.bat (cannot be terminated). /T:bf Sets the background/foreground color (see COLOR command). Modify file extension associations. assoc [.ext[=[FileType]]] assoc (print all associations) assoc .ext (print specific association) assoc .ext= (remove specific association) assoc .ext=FileType (add new association) Creates a filesystem link object. MKLINK [/D | /H | /J] linkname target /D Indicates that the symbolic link target is a directory. /H Create a hard link. /J Create a directory junction. If neither /H or /J is specified, a symbolic link is created.)ReactOS Operating System [Version %s-%s] 0 ReactOS Befehlszeilen Interpreter Version %s %sLegt die standard Hinter- und Vordergrundfarben fr die Konsole fest. COLOR [attr [/F]] attr Gibt die Farbattribute fr die Konsolenausgabe an. /F fllt die Konsolenausgabe mit dem Farbattribut Es gibt 3 Mglichkeiten die Farbe festzulegen: 1) [bright] name on [bright] name (Nur die 4 ersten Buchstaben sind ntig) 2) decimal on decimal 3) two hex digits Farben: dec hex name dec hex name 0 0 Black 8 8 Gray (Bright black) 1 1 Blue 9 9 Bright Blue 2 2 Green 10 A Bright Green 3 3 Cyan 11 B Bright Cyan 4 4 Red 12 C Bright Red 5 5 Magenta 13 D Bright Magenta 6 6 Yellow 14 E Bright Yellow 7 7 White 15 F Bright White" %s berschreiben (Ja/Nein/Alle)? Kopiert eine oder mehrere Dateien an eine andere Position. COPY [/V][/Y|/-Y][/A|/B] Quelle [/A|/B] [+ source [/A|/B] [+ ...]] [destination [/A|/B]] source Bezeichnet die zu kopierende(n) Datei(en). /A Weist auf eine ASCII-Textdatei hin. /B Weist auf eine Binrdatei hin. destination Bezeichnet das Verzeichnis und/oder Dateinamen der neuen Datei(en). /V berprft, ob die Dateien richtig geschrieben wurden. /Y Unterdrckt die Besttigungsaufforderung beim berschreiben vorhandener Zieldateien. /-Y Fordert beim berschreiben vorhandener Zieldateien zum Besttigen auf. Die Option /Y ist mglicherweise in der Umgebungsvariablen COPYCMD. .... Geben Sie das neue Datum ein (mm%cdd%cyyyy): . Geben Sie das neue Datum ein (dd%cmm%cyyyy): . Geben Sie das neue Datum ein (yyyy%cmm%cdd): ndert das eingestellte Datum oder zeigt es an. DATE [/T][date] /T nur Datum anzeigen Der Befehl DATE ohne Parameter zeigt das aktuelle Datum an und fragt nach einem neuen. Drcken Sie die EINGABETASTE, um das bisherige Datum zu behalten.|Lscht eine oder mehrere Dateien. DEL [/N /P /T /Q /W /Y /Z] Dateinamen ... DELETE [/N /P /T /Q /W /Y /Z] Dateinamen ... ERASE [/N /P /T /Q /W /Y /Z] Dateinamen ... file Geben Sie die Dateinamen an welche Sie lschen mchten /N Nichts. /P Fordert Sie vor dem Lschen jeder Datei zur Besttigung auf. /T Zeigt die Anzahl der gelschten Dateien und deren vorherigen Speicherplatzbedarf an. /Q Beenden. /W Sicheres Lschen. Dateien werden mit Zufallszahlen berschrieben bevor sie gelscht werden. /Y Lscht alles (*.*) ohne Vorwarnung. /Z Lscht versteckte, mit nur leserechten und Systemdateien. JAlle Dateien in diesem Verzeichnis werden gelscht! Sind Sie sicher (Y/N)? %lu Datei(en) gelscht  %lu Datei(en) gelscht dPause fr n Sekunden oder Millisekunden DELAY [/m]n /m Millisekunden ansonsten Sekunden YListet die Dateien und Unterverzeichnisse eines Verzeichnisses auf. DIR [Laufwerk:][Pfad][Dateiname] [/A[[:]attributes]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [Laufwerk:][path][Dateiname] Bezeichnet Laufwerk, Verzeichnis und/oder Dateien. /A Listet Dateien mit angegebenen Attributen auf. attributes D Verzeichnisse R Schreibgeschtzte Dateien H Versteckte Dateien A Zu archivierende Dateien S Systemdateien - vorangestellt kehrt die Bedeutung um /B Einfaches Format (keine Kopfdaten, keine Zusammenfassung). /C Zeigt das Tausendertrennzeichen bei Dateigren an (Standard- einstellung). Verwenden Sie /-C, um das Tausendertrennzeichen nicht anzuzeigen. /D Gleich wie Breitformat, jedoch nach Spalten sortiert. /L Verwendet Kleinschreibung. /N Neues, langes Listenformat (Dateinamen auf der rechten Seite). /O Gibt die Liste sortiert aus. sortorder N Name (alphabetisch) S Gre (kleinere zuerst) E Erweiterung (alphabetisch) D Datum/Zeit (ltere zuerst) G Verzeichnisse zuerst - vorangestellt kehrt die /P Pausiert nach jeder vollen Bildschirmseite. /Q Gibt den Besitzer der Datei aus. /S Listet Dateien und alle Unterverzeichnisse auf. /T Bestimmt welche Zeit verwendet wird. timefield C Erstellung A Letzter Zugriff W Letzter Schreibzugriff /W Verwendet Breitformat fr die Auflistung. /X Zeigt die Kurznamen fr Dateien mit Nicht-8Punkt3-Namen an. Das Format ist das gleiche wie bei /N, wobei der Kurzname vor dem Langnamen eingefgt wird. Wenn kein Kurzname vorhanden ist, werden Leerzeichen angezeigt. /4 Zeigt das Jahr vierstellig an. Optionen knnen in der Umgebungsvariablen DIRCMD voreingestellt werden. "-" vor einer Option setzt die Voreinstellung ausser Kraft, z.B. DIR /-W.# Datentrger in Laufwerk %c ist %s 2 Datentrger in Laufwerk %c hat keine Bezeichnung 0 Intrprete de comandos de ReactOS Version %s %sXConfigura el color de primer plano y fondo. COLOR [attr [/-F]] attr Especifica el atributo de color de salida de consola. /-F No rellena el espacio en blanco de la consola con el color del atributo. Hay tres maneras de especificar los colores: 1) [bright] nombre on [bright] nombre (solo las tres primeras letras del nombre son necesarias) 2) decimal on decimal 3) dos dgitos hexadecimales Los colores son: dec hex nombre dec hex name 0 0 Negro 8 8 Gris(Negro brillante) 1 1 Azul 9 9 Azul brillante 2 2 Verde 10 A Verde brillante 3 3 Cyan 11 B Cyan brillante 4 4 Rojo 12 C Rojo brillante 5 5 Magenta 13 D Magenta brillante 6 6 Amarillo 14 E Amarillo brillante 7 7 Blanco 15 F Blanco brillante Sobreescribir %s (Si/No/Todos)? Copia uno o mas archivos a otro lugar. COPY [/V][/Y|/-Y][/A|/B] origen [/A|/B] [+ origen [/A|/B] [+ ...]] [destino [/A|/B]] origen Especifica el archivo o archivos a copiar. /A Indica un archivo de texto ASCII. /B Indica un archivo binario. destino Especifica el directorio y/o nombre de archivo para los nuevos archivos. /V Verifica que el nuevo archivo se ha escrito correctamente. /Y Suprime la confirmacin sobre si quieres sobreescribir un archivo de destino existente. /-Y Hace que te pregunte si quieres sobreescribir un archivo de destino existente. El parametro /Y tiene que estar presente en las variables de entorno de COPYCMD. ... * Introduce la nueva fecha (mm%cdd%cyyyy): * Introduce la nueva fecha (dd%cmm%cyyyy): * Introduce la nueva fecha (yyyy%cmm%cdd): Muestra o cambia la fecha. DATE [/T][date] /T Slo la muestra Escribe DATE sin parmetros para mostrar la fecha actual y establecer una nueva fecha. Pulsa INTRO para mantener la misma fecha. Borra uno o mas archivos. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]atributos]] archivo ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]atributos]] archivo ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]atributos]] archivo ... archivo Espacifica el/los archivo(s) a borrar. /N Nada. /P Prompt. Pregunta antes de borar cada archivo /T Total. Muestra el nmero total de archivos eliminados y el espacio liberado en disco /Q Modo silencioso. /W Limpiar. Sobreescribe el archivo con nmeros aleatorios despus de eliminarlo. /Y Si. Borra incluso *.* sin preguntar. /F Fuerza el borrade de archivos ocultos, de slo lectura y de sistema. /S Borra los archivos de todos los subdirectorios. /A Selecciona los archivos a borrar en base a los atributos especificados. R Archivos de slo lectura S Archivos de sistema A Archivos listos para archivar H Archivos ocultos - Prefijo que signifca sin LTodos los archivos del directorio van a ser borrados! Ests seguro? (S/N)? Archivo %lu borrado  Archivos %lu borrados Espera por n segundos o milisegundos DELAY [/m]n /m Especifica que n son milisegundos En otro caso n son segundos DIR [unidad:][ruta][nombre de archivo] [/A[[:]atributos]] [/B] [/C] [/D] [/L] [/N] [/O[[:]orden]] [/P] [/Q] [/S] [/T[[:]fecha]] [/W] [/X] [/4] [unidad:][ruta][nombre de archivo] Especifica la unidad, el directorio o los archivos a listar. /A Muestra los archivos con los atributos especificados. atributos D Directorios R Archivos de slo lectur H Archivos ocultos A Archivos listos para archivar S Archivos de sistema - Prefijo que signifca sin /B Usa el formato simple (sin encabezado ni sumario). /C Muestra el separador de miles en los tamaos de los archivos. Es la opcin por defecto. Usa /-C para desactivar el mostrar el separador. /D Lo mismo que el formato a lo ancho, pero ordenados en columna. /L Usa minsculas. /N Nuevo formato de lista larga donde los nombres de archivo estn a la derecha. /O Muestra los archivos ordenados segn el orden especificado. ordenacin N Por nombre (alfabtico) S Por tamao (los menores primero) E Por extensin (alfabtico) D Por fecha/hora (los antiguos primero) G Los directorios primero - Prefijo para el orden inverso /P Pausa despus de cada pantalla llena de informacin. /Q Muestra el propietario del archivo. /S Muestra los archivos en el directorio especificado y sus subdirectorios. /T Controla que campo de tiempo se muestra o es usado para ordenar: campo de tiempo C Creacin A ltimo acceso W ltima escritura /W Usa el formato de lista a lo ancho. /X Muestra los nombres cortos generados para archivos que no tienen un nombre 8.3. El formato es como /N pero con el nombre corto colocado antes del nombre largo. Si no hay nombre corto, se muestran espacios en blanco en su lugar. /4 Muestra los cuatro dgitos del ao Los modificadores pueden estar presentes en la variable de entorno de DIRCMD. Omite los ajustes previos anteponiendo a cualquier modificador - (hyphen)--por ejemplo, /-W. " El volumen en la unidad %c es %s / El volumen en la unidad %c no tiene etiqueta. : Interprteur de ligne de commandes ReactOS Version %s %s2Change les couleurs de premier et d'arrire plan. COLOR [attr [/F]] attr Spcifie l'attribut des couleurs de la console /F remplit la console avec l'attribut de couleur Il y a trois faons de spcifier les couleurs : 1) [bright] nom on [bright] nom (seules les trois premires lettres sont ncessaires) 2) dcimal on dcimal 3) deux chiffres hexadcimaux Les couleurs sont: dc hex nom dc hex nom 0 0 Black(Noir) 8 8 Gray(Bright black) 1 1 Blue(Bleu) 9 9 Bright Blue 2 2 Green(Vert) 10 A Bright Green 3 3 Cyan 11 B Bright Cyan 4 4 Red(Rouge) 12 C Bright Red 5 5 Magenta 13 D Bright Magenta 6 6 Yellow(Jaune) 14 E Bright Yellow 7 7 White(Blanc) 15 F Bright WhiteEcraser %s (Oui/Non/Tous) ? 1Copie un ou plusieurs fichiers vers une autre destination. COPY [/V][/Y|/-Y][/A|/B] source [/A|/B] [+ source [/A|/B] [+ ...]] [destination [/A|/B]] source Indique le ou les fichiers copier. /A Spcifie qu'il s'agit d'un fichier texte ASCII. /B Spcifie qu'il s'agit d'un fichier binaire. destination Indique le rpertoire ou le nom de fichier pour le(s) nouveau(x) fichier(s). /V Vrifie que les fichiers ont t copis correctement. /Y Supprime l'invite de confirmation en cas d'crasement d'un fichier destination existant. /-Y Affiche un invite de confirmation en cas d'crasement d'un fichier destination existant. Le switch /Y peut tre prsent dans la variable d'environnement COPYCMD. ) Entrer la nouvelle date (mm%cdd%cyyyy): ) Entrer la nouvelle date (dd%cmm%cyyyy): ) Entrer la nouvelle date (yyyy%cmm%cdd): Affiche ou rgle la date. DATE [/T][date] /T affiche seulement Taper DATE sans paramtre pour afficher la date courante et une invite pour entrer la nouvelle date. Appuyer sur ENTREE pour conserver la mme date.Efface un ou plusieurs fichiers. DEL [/N /P /T /Q /W /Y /Z] fichier ... DELETE [/N /P /T /Q /W /Y /Z] fichier ... ERASE [/N /P /T /Q /W /Y /Z] fichier ... fichier Specifie le(s) fichier(s) effacer. /N Rien. /P Demande. Demande avant d'effacer pour chaque fichier. /T Total. Affiche le total de fichiers effacs et l'espace disque libr. /Q Silencieux. /W Wipe. Ecrase le fichier avec des nombres alatoires avant d'effacer. /Y Oui. Efface, mme *.*, sans demander. /F Force la suppression des fichiers cachs, en lecture-seule et systme. /S Supprime les fichiers de tous les sous-rpertoires. /A Slectionne les fichiers supprimer en fonction des attributs. attributs R Fichiers en lecture-seule S Fichiers systme A Fichiers archivables H Fichiers cachs - prfixe signifiant ne pas HTous les fichiers du rpertoire seront effacs! Etes vous sr(e) (O/N) ? %lu fichier effac  %lu fichiers effacs Attend pendant n secondes ou millisecondes DELAY [/m]n /m spcifie que n est en millisecondes sinon n est en secondesDIR [lecteur:][chemin][fichier] [/A[[:]attributs]] [/B] [/C] [/D] [/L] [/N] [/O[[:]ordredetri]] [/P] [/Q] [/S] [/T[[:]heure]] [/W] [/X] [/4] [lecteur:][chemin][fichier] Spcifie le disque, le rpertoire, et/ou les fichiers lister. /A Affiche les fichiers avec les attributs indiqus. attributs D Rpertoires R Fichiers en lecture seule H Fichiers cachs A Fichiers prts etre archivs S Fichiers systmes - Prfixe signifiant non /B Utilise le format court (pas d'informations ni de rsum). /C Affiche le sparateur de milliers dans les tailles de fichier. C'est l'option par dfaut. Utiliser /-C pour dsactiver l'affichage du sparateur. /D Identique au format large mais les fichiers sont tris par colonne. /L Utilise les minuscules. /N Nouveau format de liste longue o les noms de fichiers sont sur la droite. /O Lister les fichiers de faon trie. ordre de N Par nom (alphabtique) S Par taille (plus petit d'abord) tri E Par extension tique) D Par date (plus vieux d'abord) G Rpertoires d'abord - Prfixe pour inverser l'ordre /P S'arrte aprs chaque page d'information. /Q Affiche le propritaire du fichier. /S Affiche les fichiers dans le rpertoire indiqu et tous les sous-rpertoires. /T Contrle quel champ de temps sera affich ou utilis pour le tri C Cration A Dernier accs W Dernire modification /W Utilise le format de liste large. /X Ceci affiche les noms de fichiers courts pour les noms de fichiers longs. Le format est comme pour /N avec le nom de fichier court insr avant le nom de fichier long. S'il n'y a pas de nom court, des espaces seront affichs. /4 Affiche l'anne sur quatre chiffres. Les paramtres peuvent tre mmoriss dans la variable d'environnement DIRCMD. Modifier les paramtres mmoriss avec un - (tiret)--par exemple, /-W. ' Le nom de volume du lecteur %c est %s ( Le lecteur %c n'a pas de nom de volume 8 Interprete di linea di comando di ReactOS Version %s %s0Definisce i colori predefiniti di primo piano e sfondo. COLOR [attr [/-F]] attr Indica gli attributi di colore per i messaggi su console /-F Non riempie lo spazio vuoto della console con gli attributi di colore Ci sono tre modi per indicare i colori: 1) [bright] nome su [bright] nome (sono necessarie solo le prime tre lettere) 2) decimale su decimale 3) due cifre esadecimali I colori sono: dec esa name dec esa nome 0 0 Nero 8 8 Grigio (Nero acceso) 1 1 Blu 9 9 Blu acceso 2 2 Verde 10 A Verde acceso 3 3 Ciano 11 B Ciano acceso 4 4 Rosso 12 C Rosso acceso 5 5 Magenta 13 D Magenta acceso 6 6 Giallo 14 E Giallo acceso 7 7 Bianco 15 F Bianco acceso Sovrascrivi %s (Si/No/Tutti)? Copia uno o pi file in un'altra destinazione. COPY [/V][/Y|/-Y][/A|/B] sorgente [/A|/B] [+ sorgente [/A|/B] [+ ...]] [destinazione [/A|/B]] sorgente Inica il file o i file da copiare. /A Indica un file di testo ASCII. /B Indica un file binario. destinazione Indica la cartella e/o il nome di file per i nuovi/o file. /V Verifica che i file sono stati scritti correttamente. /Y Elimina le richieste di conferma per le sovrascrittura di un file di destinazione gi esistente. /-Y Effettua le richieste di conferma per le sovrascrittura di un file di destinazione gi esistente. La selezione /Y pu trovarsi nella variabile di ambiente COPYCMD . ... & Scrivi la nuova data (mm%cdd%cyyyy): & Scrivi la nuova data (dd%cmm%cyyyy): ' nScrivi la nuova data (yyyy%cmm%cdd): Visualizza o imposta la nuova data. DATE [/T][data] /T Visualizzazione Scrivi DATE senza parametri per visualizzare la data attuale e chiedere quella nuova. Premi ENTER per mantenerla inalterata. [Cancella uno o pi file. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributi]] file ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributi]] file ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributi]] file ... file Indica i file da cancellare. /N Nulla. /P Chiede conferma per ogni file. /T Totali. Visualizza il numero di file cancellati e lo spazio liberato. /Q Tacito. /W Sovrascive con valori casuali prima di cancellare. /Y Cancella anche *.* senza chiedere conferma. /F Forza la cancellazione di file nascosti, di sistema o in sola lettura. /S Cancella i file anche nelle sottocartelle /A Seleziona i file da cancellare in base agli attributi. attributi R Sola lettura S Sistema A Archiviabile H nascosto - prefisso con il significato di non ATutti i file nella cartella saranno cancellati! Sei sicuro (S/N)? %lu file cancellato  %lu file cancellati aspetta per il tempo indicato in secondi o millisecondi DELAY [/m]n /m precisa che n in millisecondi altrimenti n in secondi DIR [disco:][percorso][nomefilen] [/A[[:]attributi]] [/B] [/C] [/D] [/L] [/N] [/O[[:]orderinamento]] [/P] [/Q] [/S] [/T[[:]tempo]] [/W] [/X] [/4] [disco:][percorso][nomefilen] Indica disco, percorso e/o file da elencare. /A Visualizza i file con gli attributi indicati. attributes D Cartelle R Sola lettura H file nascosti A Archiviabile S file di sistema - Prefisso con il significato di non /B Formato essenziale (nessuna intestazione o sintesi). /C Visualizza il separatore delle migliaia nella dimensione dei file. Questa la norma. Usa /-C per non visualizzarlo. /D Ugualmente largo ma i file sono ordinati per colonne. /L Usa minuscole. /N Nuovo formato con i nomi dei file sulla estrema destra. /O Elenca i file ordinati. sortorder N Per nome (alfabetico) S Dimensione (per primo il pi piccolo) E Estensione (alfabetico) D By date/time (per primo il pi vecchio) G Le cartelle per prime - Prefisso per invertire l'ordine /P Pasa dopo ogni schermata piena. /Q Visualizza il proprietario del file. /S Visualizza i file nella cartella indicata e nelle sottocartelle. /T Sceglie quale campo di tempo usato per gli ordinamenti. timefield C Creazione A Ultimo Accesso W Ultima scrittura /W Usa il formato largo. /X Visualizza i nomi brevi corrispondenti a quelli estesi non-8.3 Il formato analogo a quello di /N con inseriti i nomi brevi prima dei nomi lunghi. Se non c' un nome breve vengono messi degli spazi /4 Visualizza gli anni su quattro cifre Le selezioni possono trovarsi nella variabile di ambienteDIRCMD. Sovrascrivi le selezioni preimpostate mettendo - (trattino) prima della selezione per esempio, /-W.  Il Volume nel disco %c %s * Il Volume nel disco %c non ha etichetta. # ReactOS Kommandotolk Versjon %s %sVelg standard forgrunns- og bakgrunnsfarger. COLOR [attr [/-F]] attr Spesifisere fargeattributter for konsollteksten /-F Fyller ikke blank plass med fargeattributter Det er tre nter spesifisere fargene: 1) [bright] navn p [bright] navn (bare de tre frste bokstaver er krevet) 2) desimal p desimal 3) to hexadecimale siffer Fargene er: dec hex navn dec hex navn 0 0 Svart 8 8 Gr(lys svart) 1 1 Bl 9 9 Lys Bl 2 2 Grnn 10 A Lys Grnn 3 3 Cyan 11 B Lys Cyan 4 4 Rd 12 C Lys Rd 5 5 Magenta 13 D Lys Magenta 6 6 Gult 14 E Lys Gult 7 7 Hvit 15 F Lys Hvit "Vil du erstatte %s (Ja/Nei/Alle)? Kopierer en eller flere filer til annen plassering. COPY [/V][/Y|/-Y][/A|/B] kilde [/A|/B] [+ kilde [/A|/B] [+ ...]] [ml [/A|/B]] kilde Spesifiserer filen eller filer som kopieres. /A Indikerer en ASCII tekst fil. /B Indikerer en binr fil. ml Spesifiserer mappen og/eller filnavn for den nye fil(ene). /V Bekreftet at nye filer er skrevet korrekt. /Y Undertrykker sprsml om godkjenne hvorvidt du nsker overskrive en eksisterende destinasjonsfil. /-Y Automatisk bekreftelse om at du nsker overskrive en eksisterende destinasjonsfil. Bryteren /Y kan eksistere i COPYCMD miljvariabel. ... # Skriv inn ny dato (mm%cdd%cyyyy): # Skriv inn ny dato (dd%cmm%cyyyy): # Skriv inn ny dato (yyyy%cmm%cdd): Vis eller endre datoen. DATO [/T][dato] /T Vis bare Skriv DATO uten parametere for vise gjeldende datoinnstillinger og sprsml om ny dato. Trykk ENTER for beholde samme dato. cSlett en eller flere filer. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributter]] fil ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributter]] fil ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributer]] fil ... fil Spesifisere file(r) for sletting. /N Ingenting. /P Spr fr sletting av hver fil. /T Total. Vis totalt antall slettede filer og frigjort diskplass. /Q Stille. /W Overskriv. Overskrive fil med tilfeldig data fr sletting. /Y Ja. Behandle ogs *.* uten sprre. /F Tvinge sletting av skjulte, skrivebeskyttet og systemfiler. /S Slett filer fra alle undermapper /A Velg filer til som skal slettes basert p attributter. attributter R Skrivebeskyttede filer S System filer A Arkiv filer H Skjulte filer - prefiks som betyr IKKE. (f.eks -R) 8Alle filer i mappen vil bli slettet! Er du sikker (J/N)? %lu fil slettet  %lu filer slettet pause i n sekunder eller mikrosekunder DELAY [/m]n /m spesifiserer at n er mikrosekunder ellers er n sekunder DIR [stasjon:][mappe][filnavn] [/A[[:]attributter]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortering]] [/P] [/Q] [/S] [/T[[:]tidsfelt]] [/W] [/X] [/4] [stasjon:][mappe][filnavn] Spesifisere stasjon, mappe, og/eller filer som skal listes. /A Vis filer ved spesifisere attributter. attributter D mapper R Skrivebeskyttede filer H Skjulte filer A Filer klar for arkivering S System filer - Prefiks som betyr IKKE /B Bruker rent filnavnformat (uten overskrift og oppsummering). /C Vis tusenskilletegn i filstrrelse. Dette er standard- innstillingen. Bruk /-C for deaktivere visning av skilletegn. /D Samme som fullt listeformat, men filer oppfres i kolonner. /L Bruker sm bokstaver. /N Langt listeformat hvor filenavnene vises helt til hyre. /O Liste til filene i sortert rekkeflge. sortering N Etter navn (alfabetisk) S Etter strrelse (minste frst) E Etter filendelse (alfabetisk) D Etter dato/tid (eldste frst) G Gruppere mapper frst - Prefiks for reversere orden /P Pause etter hvert hele skjermbilde. /Q Viser hvem som eier filen. /S Viser alle filer i angitt mappe og alle undermapper. /T Styrer hvilket tidsfelt som vises eller blir brukt for sortering timefelt C Opprettet A Sist lest W Sist skrevet /W Bruk fullt listeformat. /X Viser kort navn (8+3) generert for lange filnavn. Formatet er som for av /N med kort navn innsatt i kolonne fr lang navn. Hvis det ikke finnes kort navn blir blankt navn vist i dens plass. /4 Vis firesifrede rstall Brytere kan bli forhndssatt i DIRCMD miljvariabel. Overstyr forhndsinnstilte brytere ved sette en bindestrek (-) foran, for eksempel, /-W.  Volumet i stasjon %c er %s $ Volumet i stasjon %c er uten navn. / ReactOS Command Line Interpreter Version %s %sg          . COLOR [ [/-F]]           /-F Does not fill the console blank space with color attribute  3      : 1) []   []  (     ) 2)    3)    Colors are: dec hex  dec hex  0 0  8 8  (Bright black) 1 1  9 9   2 2  10 A   3 3  11 B   4 4  12 C   5 5  13 D   6 6  14 E   7 7  15 F   Overwrite %s (//)?        . COPY [/V][/Y|/-Y][/A|/B]  [/A|/B] [+ source [/A|/B] [+ ...]] [ [/A|/B]]    ()  . /A     ASCII. /B    .     /    . /V       . /Y            . /-Y           .   /Y         COPYCMD. ... )    (mm%cdd%cyyyy): )    (dd%cmm%cyyyy): )    (yyyy%cmm%cdd):     . DATE [/T][] /T    DATE             .  ENTER     .     . DEL [/N /P /T /Q /S /W /Y /Z /A[[:]]]  ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]]]  ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]]]  ...    ()  . /N . /P        . /T            . /Q    .. /W Wipe. Overwrite the file with random numbers before deleting it. /Y Yes. Kill even *.* without asking. /F          . /S        . /A      . R     S   A     H   -     @      !   (Y/N)? %lu    %lu     n    DELAY [/m]n /m specifiy than n are milliseconds otherwise n are seconds DIR [:][][] [/A[[:]]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [:][][]   ,  /      . /A      .. attributes D  R     H   A     S   -     /B    (    ). /C       .    .   /-C       .n /D              . /L   . /N           . /O     .   N   () S   (  ) E   () D  / (  ) G     -      /P       . /Q     . /S           . /T               C  A   W   /W     . /X This displays the short names generated for non-8dot3 file names. The format is that of /N with the short name inserted before the long name. If no short name is present, blanks are displayed in its place. /4 Displays four-digit years Switches may be preset in the DIRCMD environment variable. Override preset switches by prefixing any switch with - (hyphen)--for example, /-W.  Volume in drive %c is %s " Volume in drive %c has no label. / ReactOS Command Line Interpreter Version %s %sSets the default foreground and background colors. COLOR [attr [/-F]] attr Specifies color attribute of console output /-F Does not fill the console blank space with color attribute There are three ways to specify the colors: 1) [bright] name on [bright] name (only the first three letters are required) 2) decimal on decimal 3) two hex digits Colors are: dec hex name dec hex name 0 0 Black 8 8 Gray(Bright black) 1 1 Blue 9 9 Bright Blue 2 2 Green 10 A Bright Green 3 3 Cyan 11 B Bright Cyan 4 4 Red 12 C Bright Red 5 5 Magenta 13 D Bright Magenta 6 6 Yellow 14 E Bright Yellow 7 7 White 15 F Bright White Overwrite %s (Yes/No/All)? Copies one or more files to another location. COPY [/V][/Y|/-Y][/A|/B] source [/A|/B] [+ source [/A|/B] [+ ...]] [destination [/A|/B]] source Specifies the file or files to be copied. /A Indicates an ASCII text file. /B Indicates a binary file. destination Specifies the directory and/or filename for the new file(s). /V Verifies that new files are written correctly. /Y Suppresses prompting to confirm you want to overwrite an existing destination file. /-Y Causes prompting to confirm you want to overwrite an existing destination file. The switch /Y may be present in the COPYCMD environment variable. ... Enter new date (mm%cdd%cyyyy): Enter new date (dd%cmm%cyyyy): Enter new date (yyyy%cmm%cdd): Displays or sets the date. DATE [/T][date] /T display only Type DATE without parameters to display the current date setting and a prompt for a new one. Press ENTER to keep the same date. MDeletes one or more files. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... file Specifies the file(s) to delete. /N Nothing. /P Prompt. Ask before deleting each file. /T Total. Display total number of deleted files and freed disk space. /Q Quiet. /W Wipe. Overwrite the file with random numbers before deleting it. /Y Yes. Kill even *.* without asking. /F Force Delete hidden, read-only and system files. /S Delete file from all sub directory /A Select files to be deleted based on attributes. attributes R Read Only files S System files A Archiveable files H Hidden Files - prefix meaning not ?All files in the directory will be deleted! Are you sure (Y/N)? %lu file deleted  %lu files deleted pause for n seconds or milliseconds DELAY [/m]n /m specifiy than n are milliseconds otherwise n are seconds DIR [drive:][path][filename] [/A[[:]attributes]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [drive:][path][filename] Specifies drive, directory, and/or files to list. /A Displays files with specified attributes. attributes D Directories R Read-only files H Hidden files A Files ready for archiving S System files - Prefix meaning not /B Uses bare format (no heading information or summary). /C Display the thousand separator in file sizes. This is the default. Use /-C to disable display of separator. /D Same as wide but files are list sorted by column. /L Uses lowercase. /N New long list format where filenames are on the far right. /O List by files in sorted order. sortorder N By name (alphabetic) S By size (smallest first) E By extension (alphabetic) D By date/time (oldest first) G Group directories first - Prefix to reverse order /P Pauses after each screenful of information. /Q Display the owner of the file. /S Displays files in specified directory and all subdirectories. /T Controls which time field displayed or used for sorting timefield C Creation A Last Access W Last Written /W Uses wide list format. /X This displays the short names generated for non-8dot3 file names. The format is that of /N with the short name inserted before the long name. If no short name is present, blanks are displayed in its place. /4 Displays four-digit years Switches may be preset in the DIRCMD environment variable. Override preset switches by prefixing any switch with - (hyphen)--for example, /-W.  Volume in drive %c is %s " Volume in drive %c has no label. + ReactOS Parancssor rtelmezQ Version %s %sA konzol elQ- s httrsznt lltja be. COLOR [eh [/-F]] eh A konzol elQ- s httrsznt lltja be. /-F Nem frissti az egsz kpernyQt A sznt kt hexadecimlis szmjeggyel lehet belltani Az elrhetQ sznek: hex nv hex nv 0 Fekete 8 Szrke 1 Sttkk 9 Kk 2 Sttzld A Zld 3 Sttlila B Trkzkk 4 Bord C Vrs 5 Ciklmen D Ciklmen 6 Olva E Srga 7 Vilgos szrke F Fehr ,Fellrja a kvetkezQt: %s (Igen/Nem/Mind)? Egy vagy tbb llomnyt msol a megadott helyre. COPY [/V][/Y|/-Y][/A|/B] forrs [/A|/B] [+ forrs [/A|/B] [+ ...]] [cl [/A|/B]] forrs Megadott llomny(ok)at fogja msolni. /A Ez ASCII szveg llomny. /B Ez binris llomny. cl Megadja a cl mappt s/vagy az (j) llomnynevet. /V EllenQrzi a msolst. /Y Igennel vlaszol krdsnl. /-Y Nemmel vlaszol krdsnl. Az /Y kapcsolt a COPYCMD krnyezeti vltozban is hasznlhat.  j dtum (hh%cnn%c):  j dtum (nn%chh%c):  j dtum (%chh%cnn): Megjelenti vagy belltja a rendszerdtumot. DATE [/T][dtum] /T Csak megjelenti rd be a DATE parancsot paramter nlkl, hogy megjelentse a rendszer dtumot s bekrjen egy jat. Nyomj ENTERT-t, ha nem akarsz vltoztatni. ~Eltvolt egy vagy tbb llomnyt. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attribtumok]] llomny ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attribtumok]] llomny ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attribtumok]] llomny ... llomny Trlsre kijell llomny(ok). /N Nem csinl semmit. /P Rkrdezs minden llomnynl. /T Statisztika megjelentse a vgn. /Q Csendes zemmd. /W Wipe. Overwrite the llomny with random numbers before deleting it. /Y Minden vlaszra igen. Figyelem, *.*-ot is trli!! /F Rejtett, csak olvashat s rendszer llomnyokat is trl. /S Almappkban is trli az llomnyokat /A Attribtumok alapjn trli az llomnyokat. attributes R Csak olvashat llomnys S Rendszer llomny A Archivlt llomny H Rejtett llomnys - "Nem" prefix CMinden llomny trlve lesz a mappban! Biztosan ezt akarod (I/N)? %lu llomny trlve  %lu llomny trlve pause for n seconds or milliseconds DELAY [/m]n /m specifiy than n are milliseconds otherwise n are seconds jDIR [meghajt:][elrsi_t][llomnynv] [/A[[:]attribtumok]] [/B] [/C] [/D] [/L] [/N] [/O[[:]rendezsi_felttel]] [/P] [/Q] [/S] [/T[[:]idQ]] [/W] [/X] [/4] [meghajt:][elrsi_t][llomnyname] Az adott hely llomnyait s mappit jelenti meg. /A A megadott attribtumu llomnyokat jelenti csak meg. attributes D Mappk R Csak olvashat llomny H Rejtett llomny A Archivland llomny S Rendszer llomny - "Nem" prefix /B Fejlc s sszefoglal nlkl. /C Ezres elvlaszt jel hasznlata. Ez az alaprtelmezett, /-C a kikapcsolsa. /D Szles megjelents, oszlop szerint rendezve. /L Kisbetqk hasznlata. /N New long list format where llomnynames are on the far right. /O Rendezs az albbiak szerint. sortorder N Nv alapjn (ABC sorrend) S Mret alapjn (nvekvQ) E Kiterjeszts alapjn (ABC sorrend) D Dtum/idQ alapjn (legrgebbi elejn) G Mappk legelQl - "Nem" prefixel fordtott rendezs /P Csak egy kpernyQnyi adat megjelentse egyszerre. /Q llomny tulajdonsosnak megjelentse. /S Almappk tartalmt is megjelenti. /T Controls which time field displayed or used for sorting timefield C Ltrehozs A Utols megtekints W Utols mdosts /W Szles megjelents. /X This displays the short names generated for non-8dot3 llomny names. The format is that of /N with the short name inserted before the long name. If no short name is present, blanks are displayed in its place. /4 Ngy szmjegyq v A kapcsolk a DIRCMD krnyezeti vltozban is lehetnek. ' A (%c) meghajtban tallhat ktet %s 6 A (%c) meghajtban tallhat ktetnek nincs cmkje. / ReactOS Command Line Interpreter Version %s %s00000n000000n0MRofrJ00s0̀ofr0-[W0~0Y00 COLOR [^\'` [/-F]] ^\'` 00000QRn0r^\'`0c[W0~0Y00 /-F 00000n0zzD0f0D00zzk0o0r^\'`0i(uW0j0D00 ro0!kn0 3 .z^n0elg0c[Y00S0h0L0g0M0~0Y00 1) [r T] on [r T] (_j0n0o0gRn0 3 eW[`0Q0g0Y0) 2) [10 2pe] on [10 2pe] 3) 2 Ahn0 16 2pe r T: 102 162 r T 102 162 r T 0 0 Ҟ 8 8 ppr (f0D0Ҟ) 1 1 R 9 9 f0D0R 2 2 } 10 A f0D0} 3 3 4lr 11 B f0D04lr 4 4 d 12 C f0D0d 5 5 +} 13 D f0D0+} 6 6 Ğr 14 E f0D0Ğr 7 7 }v 15 F O0}v #%s 0 NfM0W0~0Y0L0000W0D0g0Y0K0? (Yes/No/All)? 1 d0~0_0o0pen000000%Rn04X@bk0000W0~0Y00 COPY [/V][/Y|/-Y][/A|/B] 000CQ [/A|/B] [+ 000CQ [/A|/B] [+ ...]] [000HQ [/A|/B]] 000CQ 000Y000000 (peS) 0c[W0~0Y00 /A ASCII 0000 0000h0W0f0qbD0~0Y00 /B 0000 0000h0W0f0qbD0~0Y00 000HQ eW0D00000n0000000~0_0o00000 T (peS) 0 c[W0~0Y00 /V eW0D00000L0ckW0O0fM0~00_0K0igW0~0Y00 /Y SQ0tPn0eX[n000000 NfM0Y00MRk0xn0000000 h:yW0~0[000 /-Y SQ0tPn0eX[n000000 NfM0Y00MRk0xn0000000 h:yW0~0Y00 TtX Ype COPYCMD g00000 /Y L0-[U00f0D004XTL0B00~0Y00 ... eW0D0eN0eQRW0f0O0`0U0D0 (mm%cdd%cyyyy): eW0D0eN0eQRW0f0O0`0U0D0 (dd%cmm%cyyyy): eW0D0eN0eQRW0f0O0`0U0D0 (yyyy%cmm%cdd): xeN0h:y~0_0o0-[W0~0Y00 DATE [/T][eN] /T eNn0h:yn00LD0~0Y00 00000n0c[L0j0D04XTo00s(Wn0eNL0h:yU000eW0D0eNn0eQR0 Bl000~0Y00 YfW0j0D04XTo00Enter 000bW0~0Y00 1 d0~0_0o0pen000000JRdW0~0Y00 DEL [/N /P /T /Q /S /W /Y /Z /A[[:]^\'`]] 0000 T ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]^\'`]] 0000 T ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]^\'`]] 0000 T ... 0000 T JRdY000000 (peS) 0c[W0~0Y00 /N Nothing. UO0W0~0[000 /P Prompt. T00000JRdY00MRk0xn0000000h:yW0~0Y00 /T Total. JRdU00_00000n0}peh0>eU00_00000W0h:yW0~0Y00 /Q Quiet. /W Wipe. JRdY00MRk0000000qNpeg0 NfM0W0~0Y00 /Y Yes. 00000000O(uW0f0NbJRdY00h0M000xn0000000 h:y[0Z0k0JRdW0~0Y00 /F 0h00\(u000000000 000007_6Rvk0JRdW0~0Y00 /S c[U00_000000Y0y0f0n000000000K00JRdW0~0Y00 /A ^\'`k000JRdY0000000xbW0~0Y00 ^\'` R 0S0\(u S 0000 0000 A 00000 H W00000 - ]0n0^\'`NY &000000n0Y0y0f0n00000L0JRdU00~0Y0! 00W0D0g0Y0K0 (Y/N)? %lu Pn000000JRdW0~0W0_0  %lu Pn000000JRdW0~0W0_0 `n y0~0_0o0 n 00y__jW0~0Y00 DELAY [/m]n /m XSMO000yk0c[W0~0Y00 c[W0j0D04XT0XSMOk0o0yL0O00~0Y00 l000000-Nn00000h0000000000Nh:yW0~0Y00 DIR [0000:][00][0000 T] [/A[[:]^\'`]] [/B] [/C] [/D] [/L] [/N] [/O[[:]000]] [/P] [/Q] [/S] [/T[[:]00000000]] [/W] [/X] [/4] [0000:][00][0000 T] Nh:yY00000000000000~0_0o000000c[W0~0Y00 /A c[U00_0^\'`n000000h:yW0~0Y00 ^\'` D 000000 R 0S0\(u H W00000 A 00000 S 0000 0000 - ]0n0^\'`NY /B 0000 Tn000h:yW0~0Y0 (QW00}L0NM0~0[00)0 /C 0000 0000Ah:SR0h:yW0~0Y00S00o0 00000n0-[g0Y00/-C h0Y00h0Ah:SR0h:yU00~0[000 /D /W h0 TX0g0Y0L0000000Rg0&Ny0fH0_0N0h:yW0~0Y00 /L \eW[g0h:yW0~0Y00 /N 0000 T0Szk0h:yY00eW0D0Nb__0O(uW0~0Y00 /O 00000&Ny0fH0f0h:yW0~0Y00 000 N TMR (0000000) S 000 (\U0D0{0F0K00) E b5_P[ (0000000) D eBf (SD0{0F0K00) G 0000 (000000K00) - M /P 1 ;ubT0h0k0\PbkW0f0h:yW0~0Y00 /Q 0000n0@b g0h:yW0~0Y00 /S c[U00_0000000J00s0]0n000000000n0Y0y0f0n0 00000h:yW0~0Y00 /T i0n0000000000h:yY00K00~0_0o0&Ny0fH0k0O(uY00K00 c[W0~0Y00 00000000 C \Obn A gB}0000 W gB}fe /W 000Nb__g0h:yW0~0Y00 /X S0n000000o0 MS-DOS b__ (8.3) NYn00000 Tk0[Y00wD0 TMR0h:yW0~0Y00wD0 TMRn0MRk0wD0 TMR0h:yY00p0dQ0p00 /N 00000h0 TX0g0Y00wD0 TMRL0j0D04XTo000000k0 j00~0Y00 /4 4 d0n0peW[g0t^0h:yW0~0Y00 tX Ype DIRCMD k000000-[g0M0~0Y00 /-W n00F0k0 - (0000) 0MRk0d0Q00h00]0n00000o0!qRk0j00~0Y00  0000 %c n000000 000o0 %s g0Y0  0000 %c k0o000000 000L0B00~0[000 0 Interpreter linii poleceD ReactOS Version %s %sUstawia domy[lny kolor tBa i tekstu. COLOR [atr [/-F]] atr Ustawienia koloru /-F Nie uzupeBnia kolorem pustych przestrzeni w konsoli Ustawienia koloru mo|na wyznaczy na trzy sposoby: 1) [jasny] nazwa on [jasny] nazwa (wystarcz pierwsze trzy litery nazwy) 2) numer_dec on numer_dec 3) dwa numery szesnastkowe Dostpne kolory: dec hex nazwa dec hex nazwa 0 0 Czarny 8 8 Szary 1 1 Niebieski 9 9 Jasnoniebieski 2 2 Zielony 10 A Jasnozielony 3 3 BBkitny 11 B JasnobBkitny 4 4 Czerwony 12 C Jasnoczerwony 5 5 Purpurowy 13 D Jasnopurpurowy 6 6 {Bty 14 E Jasno|Bty 7 7 BiaBy 15 F JaskrawobiaBy Nadpisa %s (Tak/Nie/Zawsze)? Kopiuje jeden lub wicej plikw do wskazanej lokacji. COPY [/V][/Y|/-Y][/A|/B] zrdBo [/A|/B] [+ zrdBo [/A|/B] [+ ...]] [cel [/A|/B]] zrdBo Miejsce, gdzie znajduj si plik(i) do skopiowania. /A Wymusza traktowanie plikw jako tekstowych (ASCII). /B Wymusza traktowanie plikw jako binarnych. cel Docelowy katalog/plik. /V Weryfikuje prawidBowo[ zapisu po skopiowaniu. /Y Automatycznie potwierdza ka|d prb nadpisania ju| istniejcego pliku. /-Y Wymusza ka|dorazowo potwierdzenie nadpisania ju| istniejcego pliku. Opcja /Y mo|e znalez si w[rd zmiennych [rodowiskowych COPYCMD. ... ! Podaj now dat (mm%cdd%crrrr): ! Podaj now dat (dd%cmm%crrrr): ! Podaj now dat (rrrr%cmm%cdd): Wy[wietla lub zmienia dat systemow. DATE [/T][data] /T tylko wy[wietlenie Wpisz DATE bez |adnych parametrw, by wy[wietli obecn dat i zapyta o now. Naci[nicie ENTER od razu, pozostawia obecn. eKasuje jeden lub wicej plikw. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributy]] plik ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributy]] plik ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributy]] plik ... plik Wyznacza pliki do skasowania. /N Nic. /P Zapytanie przed skasowaniem ka|dego pliku. /T Wy[wietla liczb skasowanych plikw i zwolnione przez nie miejsce. /Q Tryb cichy. /W Wymazywanie. Plik bdzie nadpisany losowym cigiem przed skasowaniem. /Y Tak. Nawet przy *.* nie bdzie pro[by o potwierdzenie. /F Wymusza kasowanie plikw Ukrytych, Systemowych i Tylko do odczytu. /S Kasuje pliki tak|e z podkatalogw /A Wybr plikw do skasowania ze wzgldu na ich atrybuty: R Tylko do odczytu S Systemowe A Archiwa H Ukryte - przedrostek NIE JWszystkie pliki w tym katalogu zostan skasowane! Czy jeste[ pewien (T/N)? %lu plik skasowany # %lu pliki(-w) skasowane(-ych) Pauzuje na n sekund lub milisekund DELAY [/m]n /m wymusza traktowanie n jako milisekund, w innym wypadku bdzie traktowane jako sekundy DIR [napd:][[cie|ka][pliki] [/A[[:]atrybuty]] [/B] [/C] [/D] [/L] [/N] [/O[[:]porzdek]] [/P] [/Q] [/S] [/T[[:]czas]] [/W] [/X] [/4] [napd:][[cie|ka][nazwa_pliku] Wyznacza liter napdu, katalog, i/lub pliki do wy[wietlenia. /A Wy[wietla pliki o okre[lonych atrybutach. atrybuty D Katalogi R Pliki tylko do odczytu H Pliki ukryte A Pliki do archiwizacji S Pliki systemowe - Przedrostek NIE /B Format minimalny (bez nagBwka i podsumowania). /C Wy[wietla separator co trzy zera w rozmiarach plikw. Opcja domy[lnie wBczona. Aby wyBczy, u|yj: /-C . /D To samo co format szeroki, ale pliki s posortowane kolumnami. /L U|ywa maBych liter. /N Nowy, dBugi format plikw, gdzie nazwy znajduj si od prawej. /O Sortowanie plikw wedBug okre[lonego porzdku. sortorder N WedBug nazwy (alfabetycznie) S WedBug rozmiaru (rosnco) E WedBug rozszerzenia (alfabet.) D WedBug daty (od najst.) G Wy[wietla najpierw katalogi - Odwraca kolejno[ /P Pauza po ka|dym peBnym ekranie. /Q Wy[wietla wBa[ciciela plikw /S Wy[wietla pliki w danym katalogu i wszystkich podkatalogach. /T Pole czasu, odpowiedzialne za wy[wietlanie/sortowanie czas C Utworzenia A Ostatniego otwarcia W Ostatniej modyfikacji /W U|ywa szerokiego formatu wy[wietlania. /X Wy[wietla krtkie nazwy, dla plikw nie w standardzie 8.3. Format jest zbli|ony do tego przy /N z krtkimi nazwami, umieszczonymi przed dBugimi. Je[li plik nie ma krtkiej nazwy, wy[wietlane jest puste pole. /4 Wy[wietla lata w formacie czterocyfrowym. Parametry mog znalez si w[rd zmiennych [rodowiskowych DIRCMD. Mo|na odwrci dziaBanie parametrw przedrostkiem - (my[lnik)-- na przykBad, /-W. ' Wolumin w napdzie %c ma etykiet: %s - Wolumin w napdzie %c nie posiada etykiety. 5 =B5@?@5B0B>@ :><0=4=>9 AB@>:8 ReactOS Version %s %s#AB0=>2:0 F25B>2 ?> C<>;G0=8N 4;O B5:AB0 8 D>=0. COLOR [F25B0 [/-F]] F25B0 B@81CBK F25B>2 4;O B5:AB>2KE >:>= /-F 5 70;820BL =570?>;=5==K5 <5AB0 F25B>< ABL B@8 A?>A>10 >1>7=0G0BL F25B0: 1) ?> =0720=8N =0 0=3;89A:>< O7K:5 (B@51CNBAO B>;L:> ?5@2K5 B@8 1C:2K F25B0) 2) 2 2845 45AOB8G=KE G8A5; (decimal on decimal) 3) 420 H5AB=04F0B5@8G=KE G8A;0 "01;8F0 F25B>2: 45A. H5AB.=0720=85 45A. H5AB.=0720=85 0 0 = '5@=K9 8 8 = !5@K9 1 1 = !8=89 9 9 = !25B;>-A8=89 2 2 = 5;5=K9 10 A = !25B;>-75;5=K9 3 3 = >;C1>9 11 B = !25B;>-3>;C1>9 4 4 = @0A=K9 12 C = !25B;>-:@0A=K9 5 5 = 8;>2K9 13 D = !25B;>-;8;>2K9 6 6 = 5;BK9 14 E = !25B;>-65;BK9 7 7 = 5;K9 15 F = /@:>-15;K9 5@570?8A0BL %s (Yes/No/All)? >?8@>20=85 >4=>3> 8;8 =5A:>;L:8E D09;>2 2 4@C3>5 <5AB>. COPY [/V][/Y|/-Y][/A|/B] 8AB>G=8: [/A|/B] [+ 8AB>G=8: [/A|/B] [+ ...]] [@57C;LB0B [/A|/B]] 8AB>G=8: <5=0 >4=>3> 8;8 =5A:>;L:8E :>?8@C5<KE D09;>2. /A $09; O2;O5BAO B5:AB>2K< D09;>< ASCII. /B $09; O2;O5BAO 42>8G=K< D09;><. @57C;LB0B 0B0;>3 8/8;8 8<O 4;O :>=5G=KE D09;>2. /V @>25@:0 ?@028;L=>AB8 :>?8@>20=8O D09;>2. /Y >402;5=85 70?@>A0 ?>4B25@645=8O =0 ?5@570?8AL ACI5AB2CNI53> @57C;LB8@CNI53> D09;0. /-Y 1O70B5;L=K9 70?@>A ?>4B25@645=8O =0 ?5@570?8AL ACI5AB2CNI53> @57C;LB8@CNI53> D09;0. ;NG /Y <>6=> CAB0=>28BL G5@57 ?5@5<5==CN A@54K COPYCMD. ... $ 2548B5 =>2CN 40BC (<<%c44%c3333): $ 2548B5 =>2CN 40BC (44%c<<%c3333): $ 2548B5 =>2CN 40BC (3333%c<<%c44): K2>4 8;8 87<5=5=85 40BK. DATE [/T][40B0] /T 5 70?@0H820BL 22>4 =>2>9 40BK ><0=40 DATE 157 ?0@0<5B@>2 >B>1@0605B B5:CICN 40BC 8 70?@0H8205B 22>4 =>2>9 40BK. ;O A>E@0=5=8O B5:CI59 40BK =06<8B5 :;028HC ENTER. *#40;5=85 >4=>3> 8;8 =5A:>;L:8E D09;>2. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]0B@81CBK]] 8<5=0_D09;>2 ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]0B@81CBK]] 8<5=0_D09;>2 ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]0B@81CBK]] 8<5=0_D09;>2 ... 8<5=0_D09;>2 <5=0 >4=>3> 8;8 =5A:>;L:8E D09;>2. /N 52K?>;=OBL =5?>A@54AB25==> >?5@0F8N C40;5=8O D09;0. /P 0?@>A =0 ?>4B25@645=85 ?5@54 C40;5=85< :064>3> D09;0. /T >:07K205B :>;8G5AB2> C40;5==KE D09;>2 8 >A2>1>482H53>AO 48A:>2>3> ?@>AB@0=AB20. /Q B:;NG5=85 70?@>A0 =0 ?>4B25@645=85 ?@8 C40;5=88 D09;>2. /W 5@5?8A0BL D09; A;CG09=K<8 40==K<8 ?5@54 C40;5=85<. /Y B:;NG5=85 70?@>A0 =0 ?>4B25@645=85 ?@8 C40;5=88 D09;>2 4065 4;O <0A:8 *.*. /F @8=C48B5;L=>5 C40;5=85 D09;>2, 4>ABC?=KE B>;L:> 4;O GB5=8O. /S #40;OBL D09; 87 2A5E ?>448@5:B>@89 /A B1>@ D09;>2 4;O C40;5=8O ?> 0B@81CB0<. R >ABC?=K9 B>;L:> 4;O GB5=8O S !8AB5<=K5 D09;K A $09;K 4;O 0@E828@>20=8O H !:@KBK5 D09;K @5D8:A "-" 8<55B 7=0G5=85  5A5 D09;K 2 :0B0;>35 1C4CB C40;5=K! K C25@5=K (Y/N)? %lu D09; C40;5=  %lu D09;>2 C40;5=> ?0C70 =0 n A5:C=4 8;8 <8;;8A5:C=4 DELAY [/m]n /m C:07K205B, GB> n >7=0G05B :>;8G5AB2> <8;;8A5:C=4 8=0G5 n >7=0G05B :>;8G5AB2> A5:C=4 {DIR [48A::][?CBL][8<O_D09;0] [/A[[:]0B@81CBK]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [48A::][?CBL][8<O_D09;0] 8A:, :0B0;>3 8/8;8 D09;K, :>B>@K5 A;54C5B 2:;NG8BL 2 A?8A>:. /A K2>4 D09;>2 A C:070==K<8 0B@81CB0<8. 0B@81CBK D 0B0;>38 R >ABC?=K5 B>;L:> 4;O GB5=8O H !:@KBK5 D09;K A $09;K 4;O 0@E828@>20=8O S !8AB5<=K5 D09;K @5D8:A "-" 8<55B 7=0G5=85  /B K2>4 B>;L:> 8<5= D09;>2. /C @8<5=5=85 @0745;8B5;O 3@C?? @07@O4>2 4;O 2K2>40 @07<5@>2 D09;>2 (?> C<>;G0=8N). ;O >B:;NG5=8O MB>3> @568<0 A;C68B :;NG /-C. /D K2>4 A?8A:0 2 =5A:>;L:> AB>;1F>2 A A>@B8@>2:>9 ?> AB>;1F0<. /L A?>;L7>20=85 =86=53> @538AB@0 4;O 8<5= D09;>2. /N B>1@065=85 8<5= D09;>2 2 :@09=5< ?@02>< AB>;1F5. /O !>@B8@>2:0 A?8A:0 >B>1@0605<KE D09;>2. ?>@O4>: N > 8<5=8 (0;D028B=0O) S > @07<5@C (A?5@20 <5=LH85) E > @0AH8@5=8N (0;D028B=0O) D > 40B5 (A?5@20 1>;55 AB0@K5) G 0G0BL A?8A>: A :0B0;>3>2 @5D8:A "-" >1@0I05B ?>@O4>: /P 0C70 ?>A;5 70?>;=5=8O :064>3> M:@0=0. /Q K2>4 A2545=89 > 2;045;LF5 D09;0. /S K2>4 A?8A:0 D09;>2 87 C:070==>3> :0B0;>30 8 53> ?>4:0B0;>3>2. /T K1>@ ?>;O 2@5<5=8 4;O >B>1@065=8O 8 A>@B8@>2:8 2@5<O C !>740=85 A >A;54=55 8A?>;L7>20=85 W >A;54=55 87<5=5=85 /W K2>4 A?8A:0 2 =5A:>;L:> AB>;1F>2. /X B>1@065=85 :>@>B:8E 8<5= 4;O D09;>2, GL8 8<5=0 =5 A>>B25BAB2CNB AB0=40@BC 8.3. $>@<0B 0=0;>38G5= 2K2>4C A :;NG>< /N, => :>@>B:85 8<5=0 D09;>2 2K2>4OBAO A;520 >B 4;8==KE. A;8 :>@>B:>3> 8<5=8 C D09;0 =5B, 2<5AB> =53> 2K2>4OBAO ?@>15;K. /4 K2>4 =><5@0 3>40 2 G5BK@5E7=0G=>< D>@<0B5 $ ">< 2 CAB@>9AB25 %c 8<55B <5B:C %s % ">< 2 CAB@>9AB25 %c =5 8<55B <5B:8. . ReactOS Command Line Interpreter Verzia %s %sSets the default foreground and background colors. COLOR [attr [/-F]] attr Specifies color attribute of console output /-F Does not fill the console blank space with color attribute There are three ways to specify the colors: 1) [bright] name on [bright] name (only the first three letters are required) 2) decimal on decimal 3) two hex digits Colors are: dec hex name dec hex name 0 0 Black 8 8 Gray(Bright black) 1 1 Blue 9 9 Bright Blue 2 2 Green 10 A Bright Green 3 3 Cyan 11 B Bright Cyan 4 4 Red 12 C Bright Red 5 5 Magenta 13 D Bright Magenta 6 6 Yellow 14 E Bright Yellow 7 7 White 15 F Bright White Overwrite %s (Yes/No/All)? Skopruje jeden alebo viac sborov na in umiestnenie. COPY [/V][/Y|/-Y][/A|/B] source [/A|/B] [+ source [/A|/B] [+ ...]] [destination [/A|/B]] source Specifies the file or files to be copied. /A Indicates an ASCII text file. /B Indicates a binary file. destination Specifies the directory and/or filename for the new file(s). /V Verifies that new files are written correctly. /Y Suppresses prompting to confirm you want to overwrite an existing destination file. /-Y Causes prompting to confirm you want to overwrite an existing destination file. The switch /Y may be present in the COPYCMD environment variable. ... $ Zadajte nov dtum (mm%cdd%crrrr): $ Zadajte nov dtum (dd%cmm%crrrr): $ Zadajte nov dtum (rrrr%cmm%cdd): Displays or sets the date. DATE [/T][date] /T display only Type DATE without parameters to display the current date setting and a prompt for a new one. Press ENTER to keep the same date. MDeletes one or more files. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... file Specifies the file(s) to delete. /N Nothing. /P Prompt. Ask before deleting each file. /T Total. Display total number of deleted files and freed disk space. /Q Quiet. /W Wipe. Overwrite the file with random numbers before deleting it. /Y Yes. Kill even *.* without asking. /F Force Delete hidden, read-only and system files. /S Delete file from all sub directory /A Select files to be deleted based on attributes. attributes R Read Only files S System files A Archiveable files H Hidden Files - prefix meaning not ?All files in the directory will be deleted! Are you sure (Y/N)? %lu file deleted  %lu files deleted pause for n seconds or milliseconds DELAY [/m]n /m specifiy than n are milliseconds otherwise n are seconds DIR [drive:][path][filename] [/A[[:]attributes]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [drive:][path][filename] Specifies drive, directory, and/or files to list. /A Displays files with specified attributes. attributes D Directories R Read-only files H Hidden files A Files ready for archiving S System files - Prefix meaning not /B Uses bare format (no heading information or summary). /C Display the thousand separator in file sizes. This is the default. Use /-C to disable display of separator. /D Same as wide but files are list sorted by column. /L Uses lowercase. /N New long list format where filenames are on the far right. /O List by files in sorted order. sortorder N By name (alphabetic) S By size (smallest first) E By extension (alphabetic) D By date/time (oldest first) G Group directories first - Prefix to reverse order /P Pauses after each screenful of information. /Q Display the owner of the file. /S Displays files in specified directory and all subdirectories. /T Controls which time field displayed or used for sorting timefield C Creation A Last Access W Last Written /W Uses wide list format. /X This displays the short names generated for non-8dot3 file names. The format is that of /N with the short name inserted before the long name. If no short name is present, blanks are displayed in its place. /4 Displays four-digit years Switches may be preset in the DIRCMD environment variable. Override preset switches by prefixing any switch with - (hyphen)--for example, /-W.  Volume in drive %c is %s " Volume in drive %c has no label. 1 Interpreter Baris Perintah ReactOS Version %s %sMenyetel warna standar latar belakang dan depan. COLOR [attr [/-F]] attr Menetapkan atribut warna output konsol /-F Tidak memenuhi ruang kosong konsol dengan atribut warna Ada tiga cara untuk menetapkan warna: 1) [bright] nama pada [bright] nama (hanya tiga huruf pertama yang dipakai) 2) desimal pada desimal 3) dua digit heksa Warna adalah: des heksa nama des hex nama 0 0 Black 8 8 Abu-Abu(Hitam terang) 1 1 Blue 9 9 Biru Terang 2 2 Green 10 A Hijau Terang 3 3 Cyan 11 B Biru Muda Terang 4 4 Red 12 C Merah Terang 5 5 Magenta 13 D Magenta Terang 6 6 Yellow 14 E Kuning Terang 7 7 White 15 F Putih Terang Timpa %s (Ya/Tidak/Semua)? Mengcopy satu atau lebih file ke lokasi lain. COPY [/V][/Y|/-Y][/A|/B] sumber [/A|/B] [+ sumber [/A|/B] [+ ...]] [tujuan [/A|/B]] sumber Menetapkan file yang akan dicopy. /A Menunjukan file teks ASCII. /B Menunjukan file biner. tujuan Menetapkan direktori dan/atau nama file untuk file baru. /V Verifikasi bahwa file yang baru ditulis dengan benar. /Y Hilangkan pertanyaan untuk konfirmasi anda menimpa file tujuan yang sudah ada. /-Y Menyebabkan pertanyaan untuk konfirmasi anda menimpa file tujuan yang sudah ada. Saklar /Y mungkin ada dalam variabel lingkungan COPYCMD. ... ' Masukkan tanggal baru (mm%cdd%cyyyy): ' Masukkan tanggal baru (dd%cmm%cyyyy): ' Masukkan tanggal baru (yyyy%cmm%cdd): Menampilkan atau menyetel tanggal. DATE [/T][date] /T hanya menampilkan Ketik DATE tanpa parameter untuk menampilkan setelan tanggal saat ini dan meminta yang baru. Tekan ENTER untuk membiarkan tanggal tetap sama. hMenghapus satu atau lebih file. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... file Menetapkan file yang dihapus. /N Tidak ada. /P Tanya. Menanyakan sebelum menghapus setiap file. /T Total. Tampilkan total file dihapus dan ruang disk yang dibebaskan. /Q Tenang. /W Hapus. Timpa file dengan angka acak sebelum penghapusan. /Y Ya. Matikan bahkan *.* tanpa bertanya. /F Paksa hapus file yang tersembunyi, hanya-baca dan sistem. /S Hapus file dari semua subdirektori /A Pilih file yang dihapus berdasarkan atribut. attributes R File Hanya Baca S File Sistem A File Bisa Diarsipkan H File Tersembunyi - prefiks berarti tidak :Semua file dalam direktori akan dihapus! Anda yakin (Y/T)? %lu file dihapus  %lu file dihapus menunda n detik atau milidetik DELAY [/m]n /m menetapkan bahwa n adalah milidetik sebaliknya n adalah detik DIR [drive:][path][filename] [/A[[:]attributes]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [drive:][path][filename] Menetapkan drive, direktori, dan/atau files ke daftar. /A Menampilkan file dengan atribut yang ditetapkan. attributes D Direktori R File Hanya-baca H File tersemunyi A File siap diarsipkan S File Sistem - Prefiks berarti tidak /B Menggunakan format sembarang (tanpa info heading atau ringkasan). /C Menampikan pemisah ribuan dalam ukuran file. Ini adlah standar. Gunakan /-C untuk mematikan tampilan pemisah. /D Sama seperti lebar tapi file adalah daftar diurut oleh kolom. /L Menggunakan huruf kecil. /N Format daftar panjang baru dimana nama file berada jauh di kanan. /O Daftar file yang diurut berdasarkan sortorder. sortorder N Nama (Alfabetik) S Ukuran (terkecil pertama) E Ekstensi (Alfabetik) D Tanggal/Jam (terlama pertama) G Grup direktori pertama - Prefiks untuk membalik urutan /P Menunda setelah setiap layar penuh informasi. /Q Menampilkan pemilik file. /S Menampilkan file dalam direktori dan semua subdirektorinya. /T Mengontrol field waktu mana atau dipakai untuk mengurut timefield C Pembuatan A Terakhir Diakses W Terakhir Ditulis /W Menggunakan format daftar lebar. /X Ini menampilkan nama pendek yang dibuat untuk nama file non-8dot3. Format yakni /N dengan nama pendek disisipkan sebelum nama panjang. Jika tidak ada nama pendek, kosng ditampilkan dalam tempatnya. /4 Menampilkan tahun empat-digit Saklar mungkin ada dalam variabel lingkungan DIRCMD. Membatalkan saklar preset dengan mengawali setiap saklar dengan - (minus)--contohnya, /-W.  Volume di drive %c adalah %s $ Volume di drive %c tidak berlabel. / ReactOS Command Line Interpreter Version %s %sSets the default foreground and background colors. COLOR [attr [/-F]] attr Specifies color attribute of console output /-F Does not fill the console blank space with color attribute There are three ways to specify the colors: 1) [bright] name on [bright] name (only the first three letters are required) 2) decimal on decimal 3) two hex digits Colors are: dec hex name dec hex name 0 0 Black 8 8 Gray(Bright black) 1 1 Blue 9 9 Bright Blue 2 2 Green 10 A Bright Green 3 3 Cyan 11 B Bright Cyan 4 4 Red 12 C Bright Red 5 5 Magenta 13 D Bright Magenta 6 6 Yellow 14 E Bright Yellow 7 7 White 15 F Bright White Overwrite %s (Yes/No/All)? Copies one or more files to another location. COPY [/V][/Y|/-Y][/A|/B] source [/A|/B] [+ source [/A|/B] [+ ...]] [destination [/A|/B]] source Specifies the file or files to be copied. /A Indicates an ASCII text file. /B Indicates a binary file. destination Specifies the directory and/or filename for the new file(s). /V Verifies that new files are written correctly. /Y Suppresses prompting to confirm you want to overwrite an existing destination file. /-Y Causes prompting to confirm you want to overwrite an existing destination file. The switch /Y may be present in the COPYCMD environment variable. ... Enter new date (mm%cdd%cyyyy): Enter new date (dd%cmm%cyyyy): Enter new date (yyyy%cmm%cdd): Displays or sets the date. DATE [/T][date] /T display only Type DATE without parameters to display the current date setting and a prompt for a new one. Press ENTER to keep the same date. MDeletes one or more files. DEL [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... DELETE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... ERASE [/N /P /T /Q /S /W /Y /Z /A[[:]attributes]] file ... file Specifies the file(s) to delete. /N Nothing. /P Prompt. Ask before deleting each file. /T Total. Display total number of deleted files and freed disk space. /Q Quiet. /W Wipe. Overwrite the file with random numbers before deleting it. /Y Yes. Kill even *.* without asking. /F Force Delete hidden, read-only and system files. /S Delete file from all sub directory /A Select files to be deleted based on attributes. attributes R Read Only files S System files A Archiveable files H Hidden Files - prefix meaning not ?All files in the directory will be deleted! Are you sure (Y/N)? %lu file deleted  %lu files deleted pause for n seconds or milliseconds DELAY [/m]n /m specifiy than n are milliseconds otherwise n are seconds DIR [drive:][path][filename] [/A[[:]attributes]] [/B] [/C] [/D] [/L] [/N] [/O[[:]sortorder]] [/P] [/Q] [/S] [/T[[:]timefield]] [/W] [/X] [/4] [drive:][path][filename] Specifies drive, directory, and/or files to list. /A Displays files with specified attributes. attributes D Directories R Read-only files H Hidden files A Files ready for archiving S System files - Prefix meaning not /B Uses bare format (no heading information or summary). /C Display the thousand separator in file sizes. This is the default. Use /-C to disable display of separator. /D Same as wide but files are list sorted by column. /L Uses lowercase. /N New long list format where filenames are on the far right. /O List by files in sorted order. sortorder N By name (alphabetic) S By size (smallest first) E By extension (alphabetic) D By date/time (oldest first) G Group directories first - Prefix to reverse order /P Pauses after each screenful of information. /Q Display the owner of the file. /S Displays files in specified directory and all subdirectories. /T Controls which time field displayed or used for sorting timefield C Creation A Last Access W Last Written /W Uses wide list format. /X This displays the short names generated for non-8dot3 file names. The format is that of /N with the short name inserted before the long name. If no short name is present, blanks are displayed in its place. /4 Displays four-digit years Switches may be preset in the DIRCMD environment variable. Override preset switches by prefixing any switch with - (hyphen)--for example, /-W.  Volume in drive %c is %s " Volume in drive %c has no label.  Volumeseriennummer: %04X-%04X @ Anzahl der angezeigten Dateien: %16i Datei(en)% 15s Bytes '%16i Verzeichnis(se), % 15s Bytes frei  Verzeichnis von %s %16i Datei(en)% 14s Bytes Speichert das aktuelle Verzeichnis fr den POPD Befehl, und wechselt dann zu den festgelegten Verzeichnis. PUSHD [path | ..] path Legt das Verzeichnis fest zu welchem gewechselt werden sollMWechselt zu dem Verzeichnis welches vom PUSHD Befehl gespeichert wurde. POPD/Druckt den Inhalt des Verzeichnis-Stacks. DIRSVerzeichnis-Stack ist leer^Sendet eine Nachricht ohne den Zeilenvorschub und Wagenrcklauf zu bettigen. ECHOS messagesSendet eine Nachricht zur Standard Fehlerausgabe. ECHOERR Nachricht ECHOERR. gibt eine Leerzeile aus~Sendet eine Nachricht zur Standard Fehlerausgabe ohne den Zeilenvorschub und Wagenrcklauf zu bettigen. ECHOSERR NachrichtZeigt Meldungen an oder schaltet die Befehlsanzeige ein "ON" oder aus "OFF". ECHO [ON | OFF] ECHO [Nachricht] ECHO. gibt eine Leerzeile aus ECHO ohne Parameter zeigt die aktuelle Einstellung der Befehlsanzeige an. ECHO ist %s JBeendet den Befehlsinterpreter CMD.EXE oder die aktuelle Batchdatei. EXITFhrt einen Befehl fr jede einzelne Datei fr einen Satz von Dateien aus. FOR %Variable IN (Satz) DO Befehl [Parameter] %variable Ein ersetzbarer Parameter bestehend aus einem einzelnen Buchstaben. (Satz) Ein Satz von mindestens einer Datei. Platzhalter sind zulssig. Befehl Befehl, der fr jede Datei ausgefhrt werden soll. Parameter Parameter und Optionen fr den angegebenen Befehl. Um den FOR-Befehl in einem Batchprogramm zu verwenden, geben Sie %%Variable statt %Variable an.' El volumen Serial Number is %04X-%04X > Total de archivos mostrados: %16i archivo(s)% 14s bytes %16i Directorio(s)% 15s bytes  Directorio %s %16i archivo(s)% 14s bytes Almacena el directorio actual para usarlo por el comando, entonces cambia al directorio especificado. PUSHD [ruta | ..] ruta Especifica el directorio para hacerlo el directorio actual 9Cambia al directorio guardado por el comando PUSHD. POPD5Muestra el contenido de la pila de directorios. DIRSVacia la pila de directorios`Muestra un mensaje sin necesidad de pulsar intro y salta a la siguiente linea. ECHOS mensajejMuestra los mensajes de error por defecto. ECHOERR mensaje ECHOERR. Imprime una linea vaciaeMuestra mensajes en la salida estandar de error sin pulsar intro y pasa de linea. ECHOSERR mensajeMuestra un mensaje o cambia el mostrar los comandos activo/inactivo. ECHO [ON | OFF] ECHO [mensaje] ECHO. Muestra una linea vacia Escribe ECHO sin parmetros para mostrar la configuracin actual de ECHO. ECHO est %s 3Sale del interprete de la linea de comandos. EXIT Ejecuta un comando especfico para cada archivo de un grupo de archivos. FOR %variable IN (grupo) DO comando [parametros] %variable Especifica un parmetro remplazable. (set) Especifica un grupo de uno o mas archivos. Los comodines pueden usarse. command Especifica el comando a ejecutar para cada archivo. parameters Especifica los parametros o modificadores para el comando especificado. Para usar el comando FOR en un archivo por lotes, especifica %%variable en lugar de %variable. , Le numro de srie du volume est %04X-%04X ; Total de fichiers lists : %16i Fichier(s)% 14s octets %16i Rep(s)% 15s octets  Rpertoire de %s %16i Fichier(s)% 14s octets Stocke le rpertoire courant pour utilisation avec la commande POPD, ensuite change de rpertoire vers le rpertoire spcifi. PUSHD [chemin | ..] chemin Spcifie le rpertoire qui deviendra le rpertoire courantIChange de rperoire vers le rpertoire stock par la commande PUSHD POPD3Affiche le contenu de la pile de rpertoires. DIRSPile de rpertoires vide.NAffiche un message sans retour chariot ni passage la ligne. ECHOS messageAffiche un message sur le canal d'erreur. ECHOERR message ECHOERR. Affiche une ligne vide sur le canal d'erreur.gAffiche un message sur le canal d'erreur sans retour chariot ni passage la ligne. ECHOSERR messageAffiche un message ou bascule l'affichage des commandes sur on ou off. ECHO [ON | OFF] ECHO [message] ECHO. Affiche une ligne vide. Taper ECHO sans paramtre pour afficher le rglage ECHO courant. ECHO est %s Sort de l'interprteur de commandes. EXIT [/b] [CodeDeFin] /B Quitte seulement un fichier batch. En cas de lancement en dehors d'un fichier batch, cmd.exe sera quitte CodeDeFin ERRORLEVEL prendra cette valeur la sortie Excute une commande donne pour chaque fichier d'un ensemble de fichiers. FOR %variable IN (ensemble) do commande [paramtres] %variable Spcife un paramtre remplaable. (ensemble) Spcifie un ensemble d'un ou plusieurs fichiers. Des jokers peuvent tre utiliss. commande Spcifie la commande xcuter pour chaque fichier. paramtres Spcifie les paramtres ou switchs pour la commande spcifie. Pour utiliser la comamnde FOR dans un programme batch, utiliser %%variable au lieu de %variable.+ Il numero di serie del Volume %04X-%04X 0 Numero dei file elencati: %16i % 14s byte %16i Cartelle% 15s byte  Cartelle di %s %16i File% 14s byte Salva la cartella corrente per l'uso con il comando POPD, poi passa alla cartella indicata. PUSHD [percorso | ..] percorso Indica la cartella che deve diventare quella corrente 0Cambia alla cartella memorizzata da PUSHD. POPD9Visualizza il contenuto dello stack delle cartelle. DIRSStack delle cartelle vuoto;Stampa un messaggio senza andare a capo. ECHOS messaggioiStampa un messaggio sullo standard error. ECHOERR messagio ECHOERR. Stampa una linea vuotaSStampa un messaggio senza andare a capo sullo standard error. ECHOSERR messaggioVisualizza un messaggio o abilita e disabilita la visualizzazione dei comandi. ECHO [ON | OFF] ECHO [messagio] ECHO. Stampa una linea vuota Usa ECHO senza parametri pr visualizzare lo stato attuale di ECHO. ECHO %s Esce dall'interprete dei comandi. EXIT [/b] [ExitCode] /B Esce solo dalle procedure batch. Se eseguito al di fuori di un batch esce da cmd.exe ExitCode Verr assegnato a ERRORLEVELEsegue un comand specifico per ogni file indicato FOR %variabile IN (listafile) DO comando [parametri] %variabile Indica un parametro sostituibile. (listafile)Indica un insieme di uno o pi file. Si possono usare i caratteri jolly. comando Indica un comando da eseguire per ogni file. parametri Indica i parametri o le selezioni per il comando. Per usare FOR in un batch usare %%variable invece di %variable. ! Volumserienummeret er %04X-%04X 2 Totalt filer listet: %16i fil(er)% 14s byte %16i mappe(r)% 15s byte  mappe av %s %16i fil(er)% 14s byte Lagrer gjeldende mappe for bruk av POPD kommando, og endrer deretter til spesifisert mappe. PUSHD [mappe | ..] mappe spesifisere mappe det endres til. 0Endre til mappe lagret fra PUSHD kommando. POPD)Skriver ut innholdet av mappeliste. DIRSMappeliste er tom:Viser meldinger uten bakerste linjeskift. ECHOS meldinguViser en melding skrevet til mottaker for feilmeldinger. ECHOERR melding ECHOERR. skriver en tom linjehSkriver en melding til standard mottaker for feilmeldinger uten bakerste linjeskift. ECHOSERR meldingVis en melding eller endre kommando echo p eller av. ECHO [P | AV] ECHO [melding] ECHO. skriv en tom linje Skriv ECHO uten parameter for vise gjeldende ECHO innstillinger. ECHO er %s Avslutt kommando linje interpreter. AVSLUTT [/b] [ExitCode] /B Avslutt bare en batch fil. Hvis det kjres en batch fil p utsiden vil den avslutte cmd.exe ExitCode Denne verdien vil bli utpekt til ERRORLEVEL ved avslutting Kjr en spesifisert kommando for hver fil i en gruppe med filer FOR %variabel IN (gruppe) DO kommando [parametere] %variable Angir en erstattelig parameter. (sett) Angir en gruppe med en eller flere filer. Jokertegn kan bli brukt. kommando Angir kommandoen som skal brukes for hver enkelt fil. parametere Angir parameterne eller bryterne for angitte kommando. For bruke FOR kommando i en satsvis fil, spesifisere %%variabel isteden for %variabel. # Volume Serial Number is %04X-%04X 2 Total Files Listed: %16i File(s)% 14s bytes %16i Dir(s)% 15s bytes free  Directory of %s %16i File(s)% 14s bytes Stores the current directory for use by the POPD command, then changes to the specified directory. PUSHD [path | ..] path Specifies the directory to make the current directory ;Changes to the directory stored by the PUSHD command. POPD1Prints the contents of the directory stack. DIRSDirectory stack emptySDisplay a messages without trailing carriage return and line feed. ECHOS messagemDisplays a message to the standard error output. ECHOERR message ECHOERR. prints an empty linenPrints a messages to standard error output without trailing carriage return and line feed. ECHOSERR messageDisplays a message or switches command echoing on or off. ECHO [ON | OFF] ECHO [message] ECHO. prints an empty line Type ECHO without a parameter to display the current ECHO setting. ECHO is %s Exits the command line interpreter. EXIT [/b] [ExitCode] /B Exits a batch file only. If run outside of a batch file it will exit cmd.exe ExitCode This value will be assigned to ERRORLEVEL on exit Runs a specified command for each file in a set of files FOR %variable IN (set) DO command [parameters] %variable Specifies a replaceable parameter. (set) Specifies a set of one or more files. Wildcards may be used. command Specifies the command to carry out for each file. parameters Specifies parameters or switches for the specified command. To use the FOR command in a batch program, specify %%variable instead of %variable. # Volume Serial Number is %04X-%04X 2 Total Files Listed: %16i File(s)% 14s bytes %16i Dir(s)% 15s bytes free  Directory of %s %16i File(s)% 14s bytes Stores the current directory for use by the POPD command, then changes to the specified directory. PUSHD [path | ..] path Specifies the directory to make the current directory ;Changes to the directory stored by the PUSHD command. POPD1Prints the contents of the directory stack. DIRSDirectory stack emptySDisplay a messages without trailing carriage return and line feed. ECHOS messagemDisplays a message to the standard error output. ECHOERR message ECHOERR. prints an empty linenPrints a messages to standard error output without trailing carriage return and line feed. ECHOSERR messageDisplays a message or switches command echoing on or off. ECHO [ON | OFF] ECHO [message] ECHO. prints an empty line Type ECHO without a parameter to display the current ECHO setting. ECHO is %s Exits the command line interpreter. EXIT [/b] [ExitCode] /B Exits a batch file only. If run outside of a batch file it will exit cmd.exe ExitCode This value will be assigned to ERRORLEVEL on exit Runs a specified command for each file in a set of files FOR %variable IN (set) DO command [parameters] %variable Specifies a replaceable parameter. (set) Specifies a set of one or more files. Wildcards may be used. command Specifies the command to carry out for each file. parameters Specifies parameters or switches for the specified command. To use the FOR command in a batch program, specify %%variable instead of %variable. ! A ktet sorozatszma: %04X-%04X 3 sszes llomny: %16i llomny(ok)% 14s bjt %16i Mappa %15s bjt %s tartalma %16i llomny %14s bjt Megjegyzi az aktulis mappt, majd tvlt egy masikra. PUSHD [elrsi_t | ..] elrsi_t Ebbe a mappba fog tvltani 2Visszalp a PUSHD ltal megjegyzett mappba. POPD)Megjelenti a megjegyzett mappkat. DIRS res a tr5Megjelenti a szveget j sor nlkl. ECHOS szvegWDisplays a message to the standard error. ECHOERR szveg ECHOERR. j sornPrints a messages to standard error output without trailing carridge return and line feed. ECHOSERR messageMegjelent egy szveget, vagy belltja a visszhangot. ECHO [ON | OFF] ECHO [zenet] ECHO. j sor Paramter nlkl megjelenti a visszang llapott. Az ECHO %s 'Kilp a parancssor rtelmezQbQl. EXIT Vgrehajt egy parancsot az sszes fjlban a megadott mappkban FOR %vltoz IN (csoport) DO parancs [paramterek] %vltoz A cserlhetQ paramter. (csoport) llomnyok csoportja. Joker-karakterek megengedettek EZT KURVRA TKELL FORDTANI :)) wildcardok helyett?. parancs Ezt a parancsot hajtja vgre minden egyes llomnnyal. paramterek Ezeket a paramtereket adja meg a parancsnak. A batch llomnyban val haszlathoz %%vltoz kell a %vltoz helyett.  00000 0000juSo0 %04X-%04X g0Y0 $ 0000n0}pe: %16i Pn00000% 14s 000 %16i Pn0000000% 15s 000  %s n0000000 %16i Pn00000% 14s 000 nPOPD 0000g0O(uY00_00k0s(Wn00000000OX[W00 c[W0_0000000k0 YfW0~0Y00 PUSHD [00 | ..] 00 s(Wn0000000h0W0f0-[Y000000000c[W0~0Y00 #PUSHD 0000g0aU00_0000000k0 YfW0~0Y00 POPD000000 0000n0N0h:yW0~0Y00 DIRS000000 0000o0zzg0Y007000000h:yW0~0Y0L00MRk000000 0000h000000000d0Q0~0[000 ECHOS 00000Bjn000k0000000h:yW0~0Y00 ECHOERR 00000 ECHOERR. zzL0QRW0~0Y00Ajn000k0000000h:yW0~0Y0L00MRk000000 0000h0 00000000d0Q0~0[000 ECHOSERR 00000000000h:yW0_0000000 000n0 ON h0 OFF 0R0fH0~0Y00 ECHO [ON | OFF] ECHO [00000] ECHO. zzL0QRW0~0Y00 s(Wn0000-[0h:yY00k0o00000000c[[0Z0k0 ECHO h0eQRW0f0O0`0U0D00ECHO o0 %s g0Y00 0000 00000000B}NW0~0Y00 EXIT c[U00_0000000000 000n0T0000k0[W0f0[LW0~0Y00 FOR %% Ype IN (000) DO 0000 [00000] %% Ype XSNeW[n0nM0cH0Sj0000000c[W0~0Y00 (000) 0000 0000c[W0~0Y0000000000O(ug0M0~0Y00 0000 T0000T0h0k0[LY0000000c[W0~0Y00 00000 c[U00_00000n000000~0_0o000000c[W0~0Y00 000 00000g0 FOR 00000O(uY00h0M0o00%% Ypen0N00k00 %%%% Ype0O(uW0f0O0`0U0D00 & Numer seryjny woluminu to: %04X-%04X 5 OgBem wy[wietonych: %16i plik(w)% 14s bajtw %16i katalog(w)% 15s bajtw  katalog %s %16i plik(w)% 14s bajtw Przechowuje obecny katalog dla potrzeb komendy POPD, nastpnie zmienia na podany. PUSHD [[cie|ka | ..] [cie|ka Okre[la [cie|k dostpu do katalogu, podawanego do komendy 9Zmienia katalog przechowywany w stosie przez PUSHD. POPD*Wy[wietla zawarto[ stosu katalogw. DIRSStos katalogw jest pusty.VWy[wietla wiadomo[ bez nastpujcych po ka|dej linii znakw CR/LF. ECHOS wiadomo[wWy[wietla wiadomo[ dla domy[lnego odbiorcy bBdw. ECHOERR wiadomo[) ECHOERR. wy[wietla pust liniZWy[wietla wiadomo[ dla domy[lnego odbiorcy bBdw bez znakw CR/LF. ECHOSERR wiadomo[Wy[wietla wiadomo[ albo wBcza/wyBcza wy[wietlanie. ECHO [ON | OFF] ECHO [wiadomo[] ECHO. wy[wietla pust lini Wpisz ECHO bez |adnych parametrw, by wy[wietli obecne ustawienie. ECHO jest %s Zamyka okno konsoli. EXIT [/b] [kod] /B Zamyka jedynie plik wsadowy. Je[li u|yty bdzie poza plikiem wsadowym, zamknie cmd.exe kod Ta warto[ zostanie przypisana do ERRORLEVEL przy wyj[ciu. Uruchamia wyznaczon komend dla ka|dego pliku w zestawie FOR %zmienna IN (zestaw) DO komenda [parametery] %zmienna Wyznacza zamienny parametr. (zestaw) Definiuje zestaw plikw. Mo|na stosowa wieloznaczniki (np. *.*) komenda Wyznacza komend do wykonania na zestawie plikw. parametry Wyznacza parametry dla podanej komendy. By u|y FOR w pliku wsadowym, oznacz zmienn jako %%zmienna zamiast %zmienna. !5@89=K9 =><5@ B><0: %04X-%04X % A53>: %16i $09;(>2)% 14s 109B %16i Dir(s)% 15s 109B  0B0;>3 of %s %16i D09;(>2)% 14s 109B !>E@0=O5B B5:CICN 48@5:B>@8N 4;O 8A?>;L7>20=8O :><0=4>9 POPD, 70B5< 87<5=O5B 55 =0 C:070==CN. PUSHD [path | ..] path #:07K205B 48@5:B>@8N, :>B>@CN =04> A45;0BL B5:CI59 J7<5=O5B B5:CICN 48@5:B>@8N =0 BC, :>B>@0O A>E@0=5=0 :><0=4>9 PUSHD. POPD+5G0B05B A>45@68<>5 AB5:0 48@5:B>@89. DIRS!B5: 48@5:B>@89 ?CAB6K405B A>>1I5=85 157 ?5@52>40 AB@>:8. ECHOS messagerK405B A>>1I5=85 2 AB0=40@B=K9 :0=0; 2K2>40 >H81>:. ECHOERR message ECHOERR. ?5G0B05B ?CABCN AB@>:Cp5G0B05B A>>1I5=85 2 AB0=40@B=K9 :0=0; 2K2>40 >H81>: 157 ?5@52>40 AB@>:8 8 2>72@0B0 :0@5B:8. ECHOSERR messageK2>4 A>>1I5=89 8 ?5@5:;NG5=85 @568<0 >B>1@065=8O :><0=4 =0 M:@0=5. ECHO [ON | OFF] ECHO [A>>1I5=85] ECHO. 2K2>4 ?CAB>9 AB@>:8 ECHO 157 ?0@0<5B@0 2K2>48B B5:CI89 @568< >B>1@065=8O :><0=4. ECHO is %s &025@H05B 8=B5@?@5B0B>@ :><0=4. EXIT 0?CA:05B C:070==CN :><0=4C 4;O :064>3> D09;0 87 =01>@0 D09;>2 FOR %?5@5<5==0O IN (=01>@) DO :><0=40 [?0@0<5B@K] %?5@5<5==0O >4AB02;O5<K9 ?0@0<5B@. (=01>@) 01>@ 87 >4=>3> 8;8 =5A:>;L:8E D09;>2. >?CA:05BAO 8A?>;L7>20=85 ?>4AB0=>2>G=KE 7=0:>2. :><0=40 ><0=40, :>B>@CN A;54C5B 2K?>;=8BL 4;O :064>3> D09;0. ?0@0<5B@K 0@0<5B@K 8 :;NG8 4;O C:070==>9 :><0=4K.  ?0:5B=KE D09;0E 4;O :><0=4K FOR 8A?>;L7C5BAO 70?8AL %%?5@5<5==0O 2<5AB> %?5@5<5==0O. # Volume Serial Number is %04X-%04X 2 Total Files Listed: %16i File(s)% 14s bytes %16i Dir(s)% 15s bytes free  Directory of %s %16i File(s)% 14s bytes Stores the current directory for use by the POPD command, then changes to the specified directory. PUSHD [path | ..] path Specifies the directory to make the current directory ;Changes to the directory stored by the PUSHD command. POPD1Prints the contents of the directory stack. DIRSDirectory stack emptySDisplay a messages without trailing carriage return and line feed. ECHOS messagemDisplays a message to the standard error output. ECHOERR message ECHOERR. prints an empty linenPrints a messages to standard error output without trailing carriage return and line feed. ECHOSERR messageDisplays a message or switches command echoing on or off. ECHO [ON | OFF] ECHO [message] ECHO. prints an empty line Type ECHO without a parameter to display the current ECHO setting. ECHO je %s Exits the command line interpreter. EXIT [/b] [ExitCode] /B Exits a batch file only. If run outside of a batch file it will exit cmd.exe ExitCode This value will be assigned to ERRORLEVEL on exit Runs a specified command for each file in a set of files FOR %variable IN (set) DO command [parameters] %variable Specifies a replaceable parameter. (set) Specifies a set of one or more files. Wildcards may be used. command Specifies the command to carry out for each file. parameters Specifies parameters or switches for the specified command. To use the FOR command in a batch program, specify %%variable instead of %variable. $ Nomor Seri Volume adalah %04X-%04X / Total File Didaftar: %16i File% 14s byte %16i Dir% 15s byte  Direktori %s %16i File% 14s byte Menyimpan direktori sekarang untuk digunakan oleh perintah POPD, lalu mengubah ke direktori yang ditetapkan. PUSHD [path | ..] path Menetapkan direktori menjadi direktori sekarang >Mengubah ke direktori yang disimpan oleh perintah PUSHD. POPD)Menampilkan isi tumpukan direktori. DIRSTumpukan direktori kosongNMenampilkan pesan tanpa diakhiri carriage return dan line feed. ECHOS pesanmMenampilkan pesan ke output kesalahan standar. ECHOERR pesan ECHOERR. menampilkan baris kosongmMenampilkan pesan ke output kesalahan standar tanpa diakhiri carriage return dan line feed. ECHOSERR pesanMenampilkan pesan atau menukar perintah echoing on atau off. ECHO [ON | OFF] ECHO [pesan] ECHO. Menampilkan baris kosong Ketik ECHO tanpa parameter untuk menampilkan setelan ECHO saat ini.ECHO adalah %s Keluar dari interpreter baris perintah. EXIT [/b] [ExitCode] /B Keluar dari hanya file batch. Jika dijalankan di luar file batch ia akan keluar dari cmd.exe ExitCode Nilai ini akan ditempatkan ke ERRORLEVEL saat keluar Menjalankan perintah yang ditetapkan untuk setiap file dalam set file FOR %variabel IN (set) DO perintah [parameter] %variabel Menetapkan parameter yang bisa diganti. (set) Mentetapkan sebuah set dari satu atau lebih file. Wildcards boleh dipakai. perintah Menetapkan perintah yang dilakukan untuk setiap file. parameter Menetapkan parameter atau saklar untuk perintah yang dieteapkan. Untuk menggunakan perintah FOR dalam program batch, tetapkan %%variable daripada %variabel. # Volume Serial Number is %04X-%04X 2 Total Files Listed: %16i File(s)% 14s bytes %16i Dir(s)% 15s bytes free  Directory of %s %16i File(s)% 14s bytes Stores the current directory for use by the POPD command, then changes to the specified directory. PUSHD [path | ..] path Specifies the directory to make the current directory ;Changes to the directory stored by the PUSHD command. POPD1Prints the contents of the directory stack. DIRSDirectory stack emptySDisplay a messages without trailing carriage return and line feed. ECHOS messagemDisplays a message to the standard error output. ECHOERR message ECHOERR. prints an empty linenPrints a messages to standard error output without trailing carriage return and line feed. ECHOSERR messageDisplays a message or switches command echoing on or off. ECHO [ON | OFF] ECHO [message] ECHO. prints an empty line Type ECHO without a parameter to display the current ECHO setting. ECHO is %s Exits the command line interpreter. EXIT [/b] [ExitCode] /B Exits a batch file only. If run outside of a batch file it will exit cmd.exe ExitCode This value will be assigned to ERRORLEVEL on exit Runs a specified command for each file in a set of files FOR %variable IN (set) DO command [parameters] %variable Specifies a replaceable parameter. (set) Specifies a set of one or more files. Wildcards may be used. command Specifies the command to carry out for each file. parameters Specifies parameters or switches for the specified command. To use the FOR command in a batch program, specify %%variable instead of %variable. Volume in Laufwerk %s ist %-11s Volume-Seriennummer: %s %16s bytes Speicherkapazitt %16s bytes belegter Speicher %16s bytes freier Speicher 8Zeigt die Volumesinformationen an. FREE [Laufwerk: ...]YVerarbeitet Ausdrcke in einer Batchdatei abhngig von Bedingungen. IF [NOT] ERRORLEVEL Nummer Befehl IF [NOT] variable1==variable2 Befehl IF [NOT] EXIST Dateiname Befehl IF [NOT] DEFINED variable Befehl NOT Befehl wird nur dann ausgefhrt, wenn die Bedingung nicht erfllt wird ERRORLEVEL number Bedingung ist erfllt, wenn das zuletzt ausgefhrte Programm einen Code grer oder gleich der Nummer zurckgibt. command Gibt den Befehl an, der bei erfllter Bedingung ausgefhrt werden soll. variable1==variable2 Bedingung ist erfllt, falls die Zeichenfolgen gleich sind. EXIST Dateiname Bedingung ist erfllt, wenn die angegebene Datei existiert. DEFINED variable Bedingung ist erfllt, wenn die angegebene Datei definiert wurde.Setzt die Ausfhrung eines Batchprogramms an einer Marke fort. GOTO Marke Marke Definiert eine Zeichenfolge als Marke in einem Batchprogramm. Marken stehen am Zeilenanfang mit einem vorangestellten Doppelpunkt.UErstellt, ndert oder lscht die Bezeichnung eines Volumes. LABEL [Laufwerk:][label]#Datentrger im Laufwerk %c: ist %s 2Datentrger im Laufwerk %c: hat keine Bezeichnung $Datentrger-Seriennummer: %04X-%04X 9Laufwerksbezeichnung (max. 11 Zeichen, ENTER fr keine)? Aktuelle Zeit: BErzeugt ein Verzeichnis. MKDIR [Laufwerk:]Pfad MD [Laufwerk:]Pfad.Zeigt die Gre des Systemspeicher an. MEMORY %12s%% Speicher geladen. %13s bytes RAM (insgesamt) %13s bytes verfgbarer RAM %13s bytes Auslagerungsdatei (insgesamt) %13s bytes verfgbare Auslagerungsdatei %13s bytes Virtueller Speicher (insgesamt) %13s bytes verfgbarer Virtueller Speicher 'Drcken Sie eine beliebige Taste . . . !berschreiben %s (Ja/Nein/Alle)? ,Verschiebt Dateien und benennt Dateien sowie Verzeichnisse um. Um eine oder mehrere Dateien zu verschieben: MOVE [/N][Laufwerk:][Pfad]Dateiname1[,...] Ziel Um ein Verzeichnis umzubenennen: MOVE [/N][Laufwerk:][Pfad]Verzeichnis1 Verzeichnis2 [Laufwerk:][Pfad]Datei1 Bezeichnet den Pfad und den Namen der zu verschiebenden Datei(en). /N Nichts. Tut alles ausser Dateien/Verzeichnisse verschieben. Derzeitige Einschrnkung: Es ist noch nicht mglich Objekte ber die Laufwerksgrenzen hinaus zu verschieben. El volumen en la unidad %s es %-11s El nmero de serie es %s %16s bytes totales de espacio en disco %16s bytes usados %16s bytes libres 9Muestra la informacin de la unidad. FREE [unidad: ...] +Ejecuta procesos condicionales en archivos por lotes. IF [NOT] ERRORLEVEL nmero comando IF [NOT] string1==string2 comando IF [NOT] EXIST archivo comando IF [NOT] DEFINED variable comando NOT Especifica que CMD solo llevar a cabo el comando si la condicin es falsa. ERRORLEVEL nmero Especifica una condicin verdadera si el ltimo programa devuelve un cdigo de salida igual o superior al nmero especificado. comando Especifica el comando a ejecutar si se cumple la condicin. string1==string2 Especifica una condicin verdadera si las cadenas de texto coinciden. EXIST archivo Especifica una condicin verdadera si existe el archivo especificado. DEFINED variable Especifica una condicin verdadera si la variable est definida. Manda al CMD a una linea etiquetada en un archivo por lotes. GOTO etiqueta etiqueta Especifica la cadena de texto usada en el archivo por lotes como etiqueta. Escriba la etiqueta en la linea misma, empezando con dos puntos.GMuestra o cambia la etiqueta de una unidad. LABEL [unidad:][etiqueta] "El volumen en la unidad %c: es %s .El volumen en la unidad %c: no tiene etiqueta ,El nmero de serie del volumen es %04X-%04X :Etiqueta del volumen (11 Caracteres, INTRO para ninguna)? La hora actual es9Crea un directorio. MKDIR [unidad:]ruta MD [unidad:]ruta3Muestra la cantidad de memoria del sistema. MEMORY  %12s%% carga de memoria. %13s bytes totales de RAM fsica. %13s bytes libres de RAM fsica. %13s bytes totales del archivo de paginacin. %13s bytes disponibles del archivo de paginacin. %13s bytes totales de memoria virtual. %13s bytes disponibles de memoria virtual. (Pulsa cualquier tecla para continuar... !Sobreescribir %s (Si/No/Todos)? Mueve archivos y renombra archivos y directorios. Para mover uno o ms archivos: MOVE [/N][unidad:][ruta]archivo1[,...] destino Para renombrar un directorio: MOVE [/N][unidad:][ruta]directorio1 directorio2 [unidad:][ruta]archivo1 Especifica la localizacin y el nombre del archivo o archivos que quieres mover. /N Nada. Hace todo menos mover archivos o directorios. Limitaciones actules: - No puedes mover un archivo o directorio de una unidad a otra. Le nom de volume du lecteur %s est %-11s Le numro de srie est %s %16s octets d'espace disque total %16s octets utiliss %16s octets libres 9Affiche les information d'un disque. FREE [lecteur: ...]Excute un traitement conditionnel dans des programmes batch. IF [NOT] ERRORLEVEL nombre commande IF [NOT] chaine1==chaine2 commande IF [NOT] EXIST nomfichier commande IF [NOT] DEFINED variable commande NOT CMD ne lancera la commande que si la condition est fausse. ERRORLEVEL nombre La condition sera vraie si le dernier programme lanc a retourn un code sortie gal ou suprieur celui indiqu. commande Indique la commande lancer si la condition est vrifie. chaine1==chaine2 La condition sera vraie si les deux chaines sont identiques. EXIST nomfichier La condition sera vraie si le fichier spcifi existe. DEFINED variable La condition sera vraie si la variable indique est dfinie.Dirige CMD vers une ligne nomme dans un script batch. GOTO label label Spcifie un champ texte utilis dans un script batch comme un label. Vous crivez un label seul sur une ligne commenant par un deux-points. LAffiche ou change le nom de volume du disque. LABEL [disque:][nomdevolume] &Le nom de volume du disque %c: est %s 'Le disque %c: n'a pas de nom de volume +Le numro de serie du volume est %04X-%04X 1Nom de volume (11 Caractres, ENTREE si aucun) ? L'heure actuelle est ?Cre un rpertoire. MKDIR [lecteur:]chemin MD [lecteur:]chemin/Affiche la quantit de mmoire systme. MEMORY* %12s%% de charge mmoire. %13s octets de RAM physique au total. %13s octets de RAM physique disponible. %13s octets de fichier d'change au total. %13s octets de fichier d'change disponible. %13s octets de mmoire virtuelle au total. %13s octets de mmoire virtuelle disponible. )Appuyer sur une touche pour continuer... Ecraser %s (Oui/Non/Tous) ? $Dplace des fichiers ou renomme des fichiers et des rpertoires. Pouur dplacer un ou plusieurs fichiers: MOVE [/N][lecteur:][nomfich1[,...] destination Pour renommer un rpertoire: MOVE [/N][lecteur:][chemin]nomrep1 nomrep2 [lecteur:][chemin]nomfich1 Indique l'endroit et le nom du ou des fichiers que vous voulez dplacer. /N Nothing. Do everything but move files or directories. Limitations actuelles : - Vous ne pouvez pas dplacer un fichier/rpertoire d'un disque un autre. ~ Il Volume del disco %s %-11s Il numero di serie %s %16s bytes totali su disco %16s bytes usati %16s bytes liberi 9Visualizza le informazioni sul disco. FREE [disco: ...] Esegue una elaborazione condizionale nei batch. IF [NOT] ERRORLEVEL numero comando IF [NOT] stringa1==stringa2 comando IF [NOT] EXIST nomefile comando IF [NOT] DEFINED variabile comando NOT Indica che il comando deve essere eseguito solo se la condizione falsa ERRORLEVEL number La condizione verificata se l'ultimo programma eseguito ha lasciato un codice d'uscita maggiore o uguale a quello indicato. command E' il comando da eseguire se la condizione verificata. string1==string2 E' verificata se sono uguali le due stringhe EXIST nomefile E' verificata se il file esiste. DEFINED variabile E' verificata se la variabile definita. Porta l'esecuzione di un batch alla linea con l'etichetta indicata. GOTO etichetta etichetta Indica il testo utilizzato come etichetta in un batch. Nel batch questa deve trovarsi da sola in una linea con davanti due punti :. JVisualizza o modifica l'etichetta di un disco. LABEL [disco:][etichetta] Il Volume nel disco %c: %s )Il Volume nel disco %c: non ha etichetta *Il numero di serie del Volume %04X-%04X 7Etichetta del disco (11 Caratteri, INVIO per nessuna)? L'ora attuale ACrea una cartella. MKDIR [disco:]percorso MD [disco:]percorso8Visualizza la quantit della memoria di sistema. MEMORY %12s%% carico di memoria. %13s byte RAM fisica totale. %13s byte RAM fisica disponibile. %13s byte file di paginazione totale. %13s byte file di paginazione disponibile. %13s byte memoria virtuale totale. %13s byte memoria virtuale totale disponibile. !Premi un tasto per continuare... Sovrascrivi %s (Si/No/Tutti)? ,Sposta i file o cambia il nome a file e cartelle. Per spostare uno o pi file: MOVE [/N][disco:][percorso]nomefile1[,...] destinazione Per rinominare una cartella: MOVE [/N][disco:][percorso]]cartella1 cartella2 [disco:][percorso]nomefile1 indica la posizione e il nome del file o dei file da spostare. /N Nulla. Effettua il comando ma senza alterare file e cartelle. Limitazioni attuali: - Non possibile spostare file e cartelle da un disco a un altero. t Volum i stasjon %s er %-11s Serienummer er %s %16s byte total lagringsplass %16s byte brukt %16s byte ledig .Vis stasjonsinformasjon. FREE [stasjon: ...] Utfre betinget behandling i satsvise programmer. IF [NOT] ERRORLEVEL nummer kommando IF [NOT] streng1==streng2 kommando IF [NOT] EXIST filnavn kommando IF [NOT] DEFINED variabel kommando NOT Spesifisere at CMD skal fortsette kommando bare hvis betingelse er falskt ERRORLEVEL nummer Angir sant vilkr dersom forrige program returnerer en sluttkodelik eller strre enn nummer spesifisert. kommando Angir hvilken kommando som skal utfres vis vilkret oppfylles. streng1==streng2 Angir et oppfylt vilkr hvis tekststrengene er like EXIST filnavn Angir et oppfylt vilkr hvis spesifisert filnavn eksisterer. DEFINED variabel Angir et oppfylt vilkr hvis spesifisert variabel er definert. Leder CMD til en merket linje i et satsvis skript. GOTO merke merke angir en tekst streng brukt i en satsvis skript. Et merke opprettes p egen linje ved skrive kolon fulgt av navn p merke.=Viser eller endrer navn p stasjon. LABEL [stasjon:][merke] Volumet i stasjon %c: er %s #Volumet i stasjon %c: er uten navn Volumserienummeret er %04X-%04X )Volumnavn (11 tegn, Enter = intet navn)? gjeldende tid er=Oppretter en mappe. MKDIR [stasjon:]mappe MD [stasjon:]mappe#Vis mengde av system minne. MEMORY %12s%% benyttet minne. %13s byte totalt fysisk RAM. %13s byte tilgjengelig fysisk RAM. %13s byte total sidevekslingsfil. %13s byte tilgjengelig sidevekslingsfil. %13s byte totalt virtuell minne. %13s byte tilgjengelig virtuell minne. !Trykk en tast for fortsette... Overskrive %s (Ja/Nei/Alle)? Flytt filer, og gi nytt navn p filer og mapper. For flytte en eller flere filer: MOVE [/N][stasjon:][mappe]filnavn1[,...] destinasjon For endre navn p en mappe: MOVE [/N][stasjon:][mappe]mappenavn1 mappenavn2 [stasjon:][mappe]filnavn1 Spesifisere plassering og navn av fil eller filer du nsker flytte. /N Ingenting. Gjr alt unntatt flytte filer eller mapper. gjeldende begrensninger: - Du kan ikke flytte en fil eller mapper fra en stasjon til en annen. t Volume in drive %s is %-11s Serial number is %s %16s bytes total disk space %16s bytes used %16s bytes free /Displays drive information. FREE [drive: ...] 6Performs conditional processing in batch programs. IF [NOT] ERRORLEVEL number command IF [NOT] string1==string2 command IF [NOT] EXIST filename command IF [NOT] DEFINED variable command NOT Specifies that CMD should carry out the command only if the condition is false ERRORLEVEL number Specifies a true condition if the last program run returned an exit code equal or greater than the number specified. command Specifies the command to carry out if the condition is met. string1==string2 Specifies a true condition if the specified text strings match. EXIST filename Specifies a true condition if the specified filename exists. DEFINED variable Specifies a true condition if the specified variable is defined. Directs CMD to a labeled line in a batch script. GOTO label label Specifies a text string used in a batch script as a label. You type a label on a line by itself, beginning with a colon.8Displays or changes drive label. LABEL [drive:][label] Volume in drive %c: is %s !Volume in drive %c: has no label "Volume Serial Number is %04X-%04X ,Drive label (11 Characters, ENTER if none)? Current time is8Creates a directory. MKDIR [drive:]path MD [drive:]path-Displays the amount of system memory. MEMORY %12s%% memory load. %13s bytes total physical RAM. %13s bytes available physical RAM. %13s bytes total page file. %13s bytes available page file. %13s bytes total virtual memory. %13s bytes available virtual memory. Press a key to continue... Overwrite %s (Yes/No/All)? Moves files and renames files and directories. To move one or more files: MOVE [/N][drive:][path]filename1[,...] destination To rename a directory: MOVE [/N][drive:][path]dirname1 dirname2 [drive:][path]filename1 Specifies the location and name of the file or files you want to move. /N Nothing. Do everything but move files or directories. Current limitations: - You can't move a file or directory from one drive to another. t Volume in drive %s is %-11s Serial number is %s %16s bytes total disk space %16s bytes used %16s bytes free /Displays drive information. FREE [drive: ...] 6Performs conditional processing in batch programs. IF [NOT] ERRORLEVEL number command IF [NOT] string1==string2 command IF [NOT] EXIST filename command IF [NOT] DEFINED variable command NOT Specifies that CMD should carry out the command only if the condition is false ERRORLEVEL number Specifies a true condition if the last program run returned an exit code equal or greater than the number specified. command Specifies the command to carry out if the condition is met. string1==string2 Specifies a true condition if the specified text strings match. EXIST filename Specifies a true condition if the specified filename exists. DEFINED variable Specifies a true condition if the specified variable is defined. Directs CMD to a labeled line in a batch script. GOTO label label Specifies a text string used in a batch script as a label. You type a label on a line by itself, beginning with a colon.8Displays or changes drive label. LABEL [drive:][label] Volume in drive %c: is %s !Volume in drive %c: has no label "Volume Serial Number is %04X-%04X ,Drive label (11 Characters, ENTER if none)? Current time is8Creates a directory. MKDIR [drive:]path MD [drive:]path-Displays the amount of system memory. MEMORY %12s%% memory load. %13s bytes total physical RAM. %13s bytes available physical RAM. %13s bytes total page file. %13s bytes available page file. %13s bytes total virtual memory. %13s bytes available virtual memory. Press a key to continue... Overwrite %s (Yes/No/All)? Moves files and renames files and directories. To move one or more files: MOVE [/N][drive:][path]filename1[,...] destination To rename a directory: MOVE [/N][drive:][path]dirname1 dirname2 [drive:][path]filename1 Specifies the location and name of the file or files you want to move. /N Nothing. Do everything but move files or directories. Current limitations: - You can't move a file or directory from one drive to another. A (%s) meghajtban lvQ ktet cmkje %-11s Sorozatszm: %s %16s bjt a teljes hely %16s bjt hasznlva %16s bjt szabad /Ktet mret informcik. FREE [meghajt: ...] BPerforms conditional processing in batch programs. IF [NOT] ERRORLEVEL number command IF [NOT] string1==string2 command IF [NOT] EXIST llomnyname command IF [NOT] DEFINED variable command NOT Specifies that CMD should carry out the command only if the condition is false ERRORLEVEL number Specifies a true condition if the last program run returned an exit code equal or greater than the number specified. command Specifies the command to carry out if the condition is met. string1==string2 Specifies a true condition if the specified text strings match. EXIST llomnyname Specifies a true condition if the specified llomnyname exists. DEFINED variable Specifies a true condition if the specified variable is defined. tirnyt egy msik cmkre a batch llomnyban. GOTO cmke cmke A megadott cmkre fog ugrani az rtelmezQ. Egy cmkt egy sorban lehet megadni, ':' -tal kezdve.QA ktet cmkjt megjelenti, vagy megvltoztatja. LABEL [meghajt:] [j_cmke] )A (%c) meghajtban lvQ ktet cmkje %s 0A (%c) megjajtban lvQ ktetnek nincs cmkje. A ktet sorozatszma %04X-%04X (j ktetcmke (11 betq, ENTER ha res)? Az aktulis idQ:ALtrehoz egy j mappt. MKDIR [meghajt:]path MD [meghajt:]path+Megjelenti a memria statisztikt. MEMORY  A memria %12s%%-a foglalt. %13s bjtnyi teljes fizikai memria. %13s bjtnyi elrhetQ memria. %13s bjt a lapozllomny. %13s bjtnyi elrhetQ a lapozllomnyban. %13s bjt a teljes virtulis memria. %13s bjtnyi elrhetQ a virtulis memribl. .A folytatshoz nyomj meg egy billentyqt . . . Fellrja %s (Igen/Nem/Mind)? thelyezi s tnevezi az llomnyokat a mappkban. Egy vagy tbb llomny thelyezshez: MOVE [/N][meghajt:][elrsi_t]llomny1[,...] cl Mappa tnevezse: MOVE [/N][meghajt:][elrsi_t]mappa1 mappa2 [meghajt:][elrsi_t]llomny1 tnevezendQ llomnyok forrsa. /N Nem helyez t semmit. Hinyossgok: - Nem lehet meghajtk kztt thelyezni llomnyokat. b 0000 %c n000000 000o0 %-11s g0Y0 0000juSo0 %s g0Y0 %16s 000: hQ0000[ϑ %16s 000: O(u-N %16s 000: zzM0[ϑ $0000k0Y00`1X0h:yW0~0Y00 FREE [0000: ...] 000 00000-Ng0agNQt0[LW0~0Y00 IF [NOT] ERRORLEVEL juS 0000 IF [NOT] eW[R1==eW[R2 0000 IF [NOT] EXIST 0000 T 0000 IF [NOT] DEFINED Ype 0000 NOT agNL0}Pn04XTk0`0Q00CMD L000000[LY00S0h00 c[W0~0Y00 ERRORLEVEL juS g_n000000n0[Lg0c[U00_0juSN Nn0B}N000 L0ԏU00_0h0M0k00agNL0wk0j000F0k0c[W0~0Y00 0000 agNL0wn0h0M0k0[LY0000000c[W0~0Y00 eW[R1==eW[R2 0000eW[RL0NY00h0M0k0agNL0wk0j000F0k0c[ W0~0Y00 EXIST 0000 T c[W0_00000 TL0X[(WY00h0M0k0agNL0wk0j000F0k0 c[W0~0Y00 DEFINED Ype c[W0_0 YpeL0[U00f0D00h0M0k0agNL0wk0j000F0k0 c[W0~0Y00 000 00000Qn00000g0c[U00f0D00Lx06R_0yRW0~0Y00 GOTO 000 000 000 00000g0000h0W0f0O(uY000000eW[R0c[W0~0Y00 000n0HQ-k0o0 : (000) 0c[W00000`0Q00XSrg0 1 Lk0eQRW0f0O0`0 U0D00/0000n000000 0000h:y~0_0o0 YfW0~0Y00 LABEL [0000:][000] 0000 %c: n000000 000o0 %s g0Y0 0000 %c: k0o000000 000L0B00~0[00l 00000 0000juSo0 %04X-%04X g0Y0600000 0000 11 eW[NQg0eQRW0f0O0`0U0D00 _j0Q00p0 Enter 000bW0f0O0`0U0D0: s(WBf;Ro0+0000000\ObW0~0Y00 MKDIR [0000:]00 MD [0000:]000000 000n0ϑ0h:yW0~0Y00 MEMORY %12s%% n0000L0O(uU00f0D0~0Y00 %13s 000: hQirt000 %13s 000: )R(uSj0irt000 %13s 000: hQ0000000 %13s 000: )R(uSj00000000 %13s 000: hQN`000 %13s 000: )R(uSj0N`000 }LY00k0o0UOK0000bW0f0O0`0U0D0 ... !%s 0 NfM0W0~0Y0L000W0D0g0Y0K0 (Yes/No/All)? )00000yRJ00s00000h0000000 T0 YfW0~0Y00 1 d0~0_0o0pen000000yRY00k0o0: MOVE [/N][0000:][00]0000 T1[,...] yRHQ 000000 T0 YfY00k0o0: MOVE [/N][0000:][00] YfMR Yf_ [0000:][00]0000 T1 yRY000000n04X@bh0 TMR0c[W0~0Y00 /N Nothing. 0000h0000000n0yRNYn0Y0y0f00LD0~0Y00 skg0n06RP: - 0000000000000puj0000000~0_0L0c0f0yRY00S0h0o0 g0M0~0[000 Wolumin w napdzie %s ma etykiet: %-11s Numer seryjny woluminu to: %s %16s bajtw na dysku ogBem %16s bajtw zajte %16s bajtw wolne EWy[wietla informacje o wolnym miejscu w napdzie. FREE [napd: ...] Wykonuje przetwarzanie warunkowe w programach wsadowych. IF [NOT] ERRORLEVEL numer komenda IF [NOT] cig_znakw1==cig_znakw2 komenda IF [NOT] EXIST plik komenda IF [NOT] DEFINED zmienna komenda NOT Oznacza, |e CMD powinien wykona dane dziaBanie tylko, je|eli warunek nie jest speBniony ERRORLEVEL numer Zwraca PRAWDA, je[li ostatni dziaBajcy program zwrciB kod bBdu rwny lub wikszy od podanego. komenda Komenda do wykonania, gdy warunek bdzie speBniony. cig1==cig2 Zwraca PRAWDA, gdy oba cigi znakw s identyczne EXIST plik Zwraca PRAWDA, je[li podany plik istnieje. DEFINED zmienna Zwraca PRAWDA, je[li podana zmienna zostaBa zdefiniowana Przekierowuje CMD do oznaczonej linii w programie wsadowym. GOTO etykieta etykieta Cig znakw, u|yty w programie wsadowym do oznaczenia linii. Mo|esz oznaczy linie dowoln etykiet, zaczynajc od dwukropka.AWy[wietla lub zmienia etykiet napdu. LABEL [napd:][etykieta] 'Wolumin w napdzie %c: ma etykiet: %s ,Wolumin w napdzie %c: nie posiada etykiety %Numer seryjny woluminu to: %04X-%04X 4Podaj etykiet (0-11 znakw, ENTER = brak etykiety) Czas bie|cy9Tworzy katalog. MKDIR [napd:][cie|ka MD [napd:][cie|ka+Wy[wietla ilo[ pamici systemowej. MEMORY %12s%% pamici zajtej. %13s bajtw pamici RAM ogBem. %13s bajtw pamici RAM dostpne. %13s bajtw w pliku stronicowania ogBem. %13s bajtw dostpnych w pliku stronicowania. %13s bajtw pamici wirtualnej ogBem. %13s bajtw pamici wirtualnej dostpne. -Naci[nij dowolny klawisz, aby kontynuowa... Nadpisa %s (Tak/Nie/Zawsze)? Przenosi, a tak|e zmienia nazwy plikw i katalogw. Aby przenie[ jeden lub wicej plikw: MOVE [/N][napd:][[cie|ka]nazwa_pliku1[,...] cel Aby zmieni nazw katalogu: MOVE [/N][napd:][[cie|ka]nazwa1 nazwa2 [napd:][[cie|ka]nazwa Wyznacza scie|k dostpu do pliku lub plikw, ktre chcesz przenie[. /N Nic. Zrb wszystko, oprcz przenoszenia plikw/katalogw. Obecne ograniczenia: - Nie mo|esz przenie[ pliku ani katalogu z jednego napdu na inny. { ">< 48A:0 %s: %-11s !5@89=K9 =><5@: %s %16s 109B >1I53> 48A:>2>3> ?@>AB@0=AB20 %16s 109B 70=OB> %16s 109B A2>1>4=> .K2>48B 8=D>@<0F8N > B><5. FREE [drive: ...] /?5@0B>@ CA;>2=>3> 2K?>;=5=8O :><0=4 2 ?0:5B=>< D09;5. IF [NOT] ERRORLEVEL G8A;> :><0=40 IF [NOT] AB@>:01==AB@>:02 :><0=40 IF [NOT] EXIST 8<O_D09;0 :><0=40 IF [NOT] DEFINED ?5@5<5==0O :><0=40 NOT 1@0I05B 8AB8==>ABL CA;>28O: 8AB8==>5 CA;>285 AB0=>28BAO ;>6=K<, 0 ;>6=>5 - 8AB8==K<. ERRORLEVEL G8A;> #A;>285 O2;O5BAO 8AB8==K<, 5A;8 :>4 2>72@0B0 ?>A;54=59 2K?>;=5==>9 ?@>3@0<<K =5 <5=LH5 C:070==>3> G8A;0. AB@>:01==AB@>:02 -B> CA;>285 O2;O5BAO 8AB8==K<, 5A;8 C:070==K5 AB@>:8 A>2?040NB. EXIST 8<O_D09;0 -B> CA;>285 O2;O5BAO 8AB8==K<, 5A;8 D09; A C:070==K< 8<5=5< ACI5AB2C5B. DEFINED ?5@5<5==0O -B> CA;>285 O2;O5BAO 8AB8==K<, 5A;8 C:070==0O ?5@5<5==0O 7040=0 :><0=40 0405B :><0=4C, 2K?>;=O5<CN ?@8 8AB8==>AB8 CA;>28O. 0 MB>9 :><0=4>9 <>65B A;54>20BL :;NG52>5 A;>2> ELSE, A;C60I55 4;O C:070=8O :><0=4K, :>B>@0O 4>;6=0 2K?>;=OBLAO 2 B>< A;CG05, 5A;8 CA;>285 ;>6=>. 5@540G0 C?@02;5=8O A>45@60I59 <5B:C AB@>:5 ?0:5B=>3> D09;0. GOTO <5B:0 label !B@>:0 ?0:5B=>3> D09;0, >D>@<;5==0O :0: <5B:0. 5B:0 4>;6=0 =0E>48BLAO 2 >B45;L=>9 AB@>:5 8 =0G8=0BLAO A 42>5B>G8O.A!>740=85, 87<5=5=85 8 C40;5=85 <5B>: B><0. LABEL [48A::][<5B:0] #">< 2 CAB@>9AB25 %c 8<55B <5B:C %s $">< 2 CAB@>9AB25 %c: =5 8<55B <5B:8 !5@89=K9 =><5@ B><0: %04X-%04X -5B:0 B><0 (11 1C:2,  4;O ?CAB>9 <5B:8)? "5:CI55 2@5<O: 4!>740=85 :0B0;>30. MKDIR [48A::]?CBL MD [48A::]?CBL&K2>4 >1J5<0 A8AB5<=>9 ?0<OB8. MEMORY %12s%% memory load. %13s 109B 2A53> D878G5A:>9 ?0<OB8. %13s 109B 4>ABC?=> D878G5A:>9 ?0<OB8. %13s 109B 2A53> 2 D09;5 ?>4:0G:8. %13s 109B 4>ABC?=> 2 D09;5 ?>4:0G:8. %13s 109B 2A53> 28@BC0;L=>9 ?0<OB8. %13s 109B 4>ABC?=> 28@BC0;L=> ?0<OB8. #06<8B5 :;028HC 4;O ?@>4>;65=8O... 5@5?8A0BL %s (Yes/No/All)? 5@5<5I5=85 D09;>2 8 ?5@58<5=>20=85 D09;>2 8 :0B0;>3>2. 5@5<5I5=85 >4=>3> 8;8 1>;55 D09;>2: MOVE [/N][48A::][?CBL]8<O_D09;01[,...] =07=0G5=85 5@58<5=>20=85 :0B0;>30: MOVE [/N][48A::][?CBL]8<O_:0B0;>301 8<O_:0B0;>302 [48A::][?CBL]8<O_D09;01 #:07K205B <5AB>?>;>65=85 8 8<O D09;0 8;8 D09;>2 :>B>@K5 =5>1E>48<> ?5@5<5AB8BL. /N Nothing. Do everything but move files or directories. "5:CI85 >3@0=8G5=8O: - 52>7<>6=> ?5@5=>A8BL D09;K 8;8 ?0?:8 <564C @07=K<8 @0745;0<8. t Volume in drive %s is %-11s Sriov slo je %s %16s bytes total disk space %16s bytes used %16s bytes free /Displays drive information. FREE [drive: ...] 6Performs conditional processing in batch programs. IF [NOT] ERRORLEVEL number command IF [NOT] string1==string2 command IF [NOT] EXIST filename command IF [NOT] DEFINED variable command NOT Specifies that CMD should carry out the command only if the condition is false ERRORLEVEL number Specifies a true condition if the last program run returned an exit code equal or greater than the number specified. command Specifies the command to carry out if the condition is met. string1==string2 Specifies a true condition if the specified text strings match. EXIST filename Specifies a true condition if the specified filename exists. DEFINED variable Specifies a true condition if the specified variable is defined. Directs CMD to a labeled line in a batch script. GOTO label label Specifies a text string used in a batch script as a label. You type a label on a line by itself, beginning with a colon.8Displays or changes drive label. LABEL [drive:][label] Volume in drive %c: is %s !Volume in drive %c: has no label "Volume Serial Number is %04X-%04X ,Drive label (11 Characters, ENTER if none)? Aktulny as je8Creates a directory. MKDIR [drive:]path MD [drive:]path-Displays the amount of system memory. MEMORY %12s%% memory load. %13s bytes total physical RAM. %13s bytes available physical RAM. %13s bytes total page file. %13s bytes available page file. %13s bytes total virtual memory. %13s bytes available virtual memory. Press a key to continue... Overwrite %s (Yes/No/All)? Moves files and renames files and directories. To move one or more files: MOVE [/N][drive:][path]filename1[,...] destination To rename a directory: MOVE [/N][drive:][path]dirname1 dirname2 [drive:][path]filename1 Specifies the location and name of the file or files you want to move. /N Nothing. Do everything but move files or directories. Current limitations: - You can't move a file or directory from one drive to another. | Volume di drive %s adalah %-11s Nomor Seri adalah %s %16s byte total ruang disk %16s byte dipakai %16s byte tersisa 0Menampilkan informasi drive. FREE [drive: ...] Melakukan pemrosesan kondisional dalam program batch. IF [NOT] ERRORLEVEL nomor perintah IF [NOT] string1==string2 perintah IF [NOT] EXIST filename perintah IF [NOT] DEFINED variabel perintah NOT Menetapkan bahwa CMD harus melakukan hanya perintah jika kondisi adalah salah ERRORLEVEL nomor Menetapkan kondisi benar jika program terakhir menghasilkan kode exit sama dengan nomor yang ditetapkan. perintah Menetapkan perintah untuk dilakukan jika kondisi dipenuhi. string1==string2 Menetapkan kondisi benar jika string teks yang ditetapkan sama. EXIST filename Menetapkan kondisi benar jika nama file ada. DEFINED variable Menetapkan kondisi benar jika variabel didefinisikan. Mengarahkan CMD ke baris berlabel dalam naskah batch. GOTO label label Menetapkan string teks yang digunakan dalam naskah batch sebagai label. Anda mengetik label pada sebuah baris, dimulai dengan titik dua.>Menampilkan atau mengubah label drive. LABEL [drive:][label] Volume di drive %c: adalah %s #Volume di drive %c: tidak berlabel #Nomor Seri Volume adalah %04X-%04X -Label Drive (11 Karakter, ENTER jika sudah)? Waktu saat ini6Membuat direktori. MKDIR [drive:]path MD [drive:]path)Menampilkan jumlah memori sistem. MEMORY %12s%% beban memori. %13s byte total fisik RAM. %13s byte fisik RAM tersedia. %13s byte total file page. %13s byte file page tersedia. %13s byte total memori virtual. %13s byte memori virtual tersedia. "Tekan tombol untuk melanjutkan... Timpa %s (Ya/Tidak/Semua)? Memindahkan file dan mengganti nama file dan direktori. Untuk memindahkan satu atau lebih file: MOVE [/N][drive:][path]filename1[,...] tujuan Untuk mengganti nama direktori: MOVE [/N][drive:][path]dirname1 dirname2 [drive:][path]filename1 Menetapkan lokasi dan nama file yang ingin anda pindahkan. /N Tidak apapun. Lakukan apapun kecuali memindahkan file dan direktori. Batasan saat ini: - Anda tidak bisa memindahkan file atau direktori dari satu drive ke lainnya. t Volume in drive %s is %-11s Serial number is %s %16s bytes total disk space %16s bytes used %16s bytes free /Displays drive information. FREE [drive: ...] 6Performs conditional processing in batch programs. IF [NOT] ERRORLEVEL number command IF [NOT] string1==string2 command IF [NOT] EXIST filename command IF [NOT] DEFINED variable command NOT Specifies that CMD should carry out the command only if the condition is false ERRORLEVEL number Specifies a true condition if the last program run returned an exit code equal or greater than the number specified. command Specifies the command to carry out if the condition is met. string1==string2 Specifies a true condition if the specified text strings match. EXIST filename Specifies a true condition if the specified filename exists. DEFINED variable Specifies a true condition if the specified variable is defined. Directs CMD to a labeled line in a batch script. GOTO label label Specifies a text string used in a batch script as a label. You type a label on a line by itself, beginning with a colon.8Displays or changes drive label. LABEL [drive:][label] Volume in drive %c: is %s !Volume in drive %c: has no label "Volume Serial Number is %04X-%04X ,Drive label (11 Characters, ENTER if none)? Current time is8Creates a directory. MKDIR [drive:]path MD [drive:]path-Displays the amount of system memory. MEMORY %12s%% memory load. %13s bytes total physical RAM. %13s bytes available physical RAM. %13s bytes total page file. %13s bytes available page file. %13s bytes total virtual memory. %13s bytes available virtual memory. Press a key to continue... Overwrite %s (Yes/No/All)? Moves files and renames files and directories. To move one or more files: MOVE [/N][drive:][path]filename1[,...] destination To rename a directory: MOVE [/N][drive:][path]dirname1 dirname2 [drive:][path]filename1 Specifies the location and name of the file or files you want to move. /N Nothing. Do everything but move files or directories. Current limitations: - You can't move a file or directory from one drive to another. Zeigt ein Fenster und wartet auf eine Eingabe vom Benutzer. MSGBOX type ['title'] prompt type Button anzeigen mgliche Werte sind: OK, OKCANCEL, YESNO, YESNOCANCEL title Titel des Fensters prompt Text der in dem Fenster angezeigt wird ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Legt den Suchpfad fr ausfhrbare Dateien fest oder zeigt diesen an. PATH [[Laufwerk:]Pfad[;...]] PATH ; PATH ; Lscht den Suchpfad und lsst CMD.EXE nur in dem aktuellen Verzeichnis suchen. PATH Ohne Parameter zeigt den aktuellen Pfad an. Hlt die Ausfhrung einer Batchdatei an und zeigt folgende Meldung oder eine benutzerdefinierte Nachricht an: 'Drcken Sie eine beliebige Taste . . .'. PAUSE [message]ndert die Eingabeaufforderung. PROMPT [Text] Text Bezeichnet die neue Eingabeaufforderung. Sie kann aus normalen Zeichen und folgenden Sonderzeichen bestehen: $A & (Kaufmnnisches Und) $B | (Verkettungszeichen oder pipe) $C ( (Klammer auf) $D Aktuelles Datum $E Escapezeichen (ASCII-Code 27) $F ) (Klammer zu) $G > (Grer-als-Zeichen) $H Rckschritt (lscht vorangehendes Zeichen) $L < (Kleiner-als-Zeichen) $N Aktuelles Laufwerk $P Aktuelles Laufwerk und Pfad $Q = (Gleichheitszeichen) $T Aktuelle Zeit $V Betriebssystem-Versionsnummer $_ Wagenrcklauf und Zeilenvorschub $$ $ (Dollarzeichen)9 $+ Zeigt die aktuelle Tiefe des Verzeichnis-Stacks an< 'PROMPT' setzt die Prompt auf die Standardwerte zurck.;Leitet Kommentare in einer Batchdatei ein. REM [Kommentar]Benennt Dateien und Verzeichnisse um. RENAME [/E /N /P /Q /S /T] alter_Name ... neuer_Name REN [/E /N /P /Q /S /T] alter_Name ... neuer_Name /E keine Fehlermeldung. /N Nichts. /P Wartet vor jedem Umbennen-Vorgang auf eine Benutzereingabe (Noch nicht implementiert!) /Q Beenden. /S benennt Unterverzeichnisse um. /T Zeigt die Anzahl der umbenannten Dateien an. Nutzen Sie den 'move' Befehl falls Sie Objekte verschieben wollen.  %lu Datei umbennant  %lu Dateien umbennant ALscht ein Verzeichnis. RMDIR [Laufwerk:]Pfad RD [Laufwerk:]PfadBewegt den Cursor und optional die Ausgabe SCREEN Reihe Spalte [Text] Reihe Reihe, in die der Curser bewegt werden soll Spalte Spalte, in die der Curser bewegt werden sollRVerndert die Position ersetzbarer Parameter in einem Batchprogramm. SHIFT [DOWN]9Setzt oder lscht Umgebungsvariablen fr CMD.EXE oder zeigt diese an. SET [variable[=][Zeichenfolge]] Variable Bezeichnet den Namen der Umgebungsvariablen. Zeichenfolge Eine Zeichenfolge, die der Variable zugewiesen werden soll. Der Befehl SET ohne Parameter zeigt die aktuellen Umgebungsvariablen an. Startet einen Befehl. START Befehl Befehl Befehl welcher ausgefhrt werden soll Achtung: Derzeit werden alle Befehle asynchron ausgefhrt. Legt den Fenstertitel fr das Eingabeaufforderungsfenster fest. TITLE [string] Zeichenfolge Bezeichnet den Titel des Eingabeaufforderungsfensters.Muestra un cuadro de mensaje y devuelve la respuesta del usuario. MSGBOX tipo ['titulo'] pregunta tipo buton a mostrar los valores posibles son: OK, OKCANCELAR, SINO, SINOCANCELAR titulo titulo del cuadro de mensaje pregunta texto a mostrar por el cuadro de mensaje ERRORLEVEL se configurara en funcin del botn pulsado: SI : 10 | NO : 11 OK : 10 | CANCELAR: 12 Muestra o cambia la ruta de bsqueda de archivos ejecutables. PATH [[unidad:]ruta[;...]] Ruta ; Escribe PATH ; para limpiar todas las configuraciones de bsqueda y usar solo el directorio actual del interprete de comandos. Escribe PATH sin parmetros para mostrar la ruta actual. Detiene la ejecucin del archivo por lotes actual y muestra el siguiente mensaje: 'Pulsa cualquier tecla para continuar...' o un mensaje definido por el usuario. PAUSE [mensaje]xCambia el smbolo de comandos. PROMPT [texto] texto Epecifica un nuevo smbolo de comandos. El smbolo de comandos puede hacerce con carcteres normales y los siguientes cdigos especiales: $A & (Signo y) $B | (Linea horizontal) $C ( (Parntesis izquierdo) $D Fecha actual $E Cdigo de escape (cdigo ASCII 27) $F ) (Parntesis derecho) $G > (Signo mayor que) $H Borra el caracter anterior $L < (Signo menor que) $N Unidad actual $P Unidad y ruta actuales $Q = (signo igual) $T Hora actual $V Nmero de versin del SO $_ Salto de linea $$ $ (signo del dolar) > $+ Muestra la profundidad actual de la pila de directoriosd Escribe PROMPT sin parmetros para resetear el smbolo de comandos a su configuracin por defecto.KComienza una liena de comentarios en un archivo por lotes REM [Comentario])Renombra un archivo/directorio o varios archivos/directorios. RENAME [/E /N /P /Q /S /T] nombre_antiguo ... nuevo_nombre REN [/E /N /P /Q /S /T] nombre_antiguo ... nuevo_nombre /E No muestra mensajes de error. /N Nada. /P Pregunta por la confirmacin antes de cada archivo. (No implementado an!) /Q Modo silencioso. /S Renombra los subdirectorios. /T Muestra el nmero total de archivos renombrados. Note que no puede especificar una nueva unidad en el destino o ruta. Usa el comando MOVE para este propsito.  %lu archivos renombrados.  %lu archivos renombrados. <Remueve un directorio. RMDIR [unidad:]ruta RD [unidad:]rutaMueve el cursor y opcionalmente escribe un texto. SCREEN fila columna [texto] fila Fila a la que mover el cursor. columna columna a la que mover el cursor.ZCambia la posicin de los parmetros remplazables en un archivo por lotes. SHIFT [ABAJO] Muestra, cambia o borra las variables de entorno. SET [variable[=][cadena]] variable Especifica el nombre de la variable de entorno. string Especifies la serie de caracteres para asignar a la variable. Escribe SET sin parmetros para mostrar las variables de entorno actuales. Empieza un comando. START comando comando Especifica el comando a ejecutar. Por el momento todos los comandos son ejecutados de forma asincrnica. Cambia el ttulo de la ventqana del intrprete de comandos. TITLE [cadena] cadena Especifica el ttulo de la ventana del intrprete de comandos. Affiche une boite de dialogue et retourne la rponse de l'utilisateur MSGBOX type ['titre'] prompt type boutons affichs les valeurs possibles sont: OK, OKCANCEL, YESNO, YESNOCANCEL titre titre de la boite de message prompt texte affich par la boite de dialogue ERRORLEVEL est modifi suivant le bouton press: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 =Affiche ou modifie le chemin de recherche pour les fichiers xcutables. PATH [[lecteur:][chemin;...]] PATH ; Taper PATH ; pour effacer tous les rglages courants et indiquer l'interprteur de commandes de chercher seulement dans le rpertoire courant. Taper PATH sans paramtres pour afficher le chemin courant. Stoppe l'xcution d'un fichier batch et affiche le message suivant: 'Appuyer sur une touche pour continuer...' ou un message dfini par l'utilisateur. PAUSE [message]Change l'invite de commandes. PROMPT [texte] texte Indique le nouvel invite de commandes. L'invite de commandes peut tre compos de caractres normaux et des caractres spciaux suivants: $A & (Et commercial) $B | (pipe) $C ( (parenthse ouvrante) $D Date courante $E Code Escape (code ASCII 27) $F ) (parenthse fermante) $G > (signe suprieur ) $H Backspace (efface le caractre prcdent) $L < (signe infrieur ) $N Lecteur courant $P Lecteur et chemin courants $Q = (signe gale) $T Heure courante $V Numro de version de ReactOS $_ Retour chariot/saut de ligne $$ $ (signe dollar)3 $+ Affiche la hauteur de la pile de rpertoiresN Taper PROMPT sans paramtres pour changer l'invite celui dfini par dfaut.KDmarrer une ligne de commentaire dans un fichier batch. REM [Commentaire]Renomme un(des) fichier(s)/rpertoire(s) RENAME [/E /N /P /Q /S /T] ancien_nom ... nouveau_nom REN [/E /N /P /Q /S /T] ancien_nom ... nouveau_nom /E Pas de messages d'erreur. /N Rien. /P Demande de confirmation avant de renommer chaque fichier. (Non implment!) /Q Silencieux. /S Renommer les sous-rpertoires. /T Affiche le nombre total de fichiers renomms. Vous ne pouvez indiquez un autre lecteur/chemin pour la destination. Utiliser la commande MOVE dans ce but. %lu fichier renomm  %lu fichiers renomms Supprime un rpertoire. RMDIR [lecteur:]chemin RD [lecteur:]chemin /S Supprime tous les fichiers et dossiers dans le rpertoire cible /Q N'interroge pas l'utilisateur Dplace le curseur, optionnellement affiche du texte SCREEN lig col [texte] lig ligne laquelle dplacer le curseur col colonne laquelle dplacer le curseurRChange la position de paramtres remplaables dans un fichier batch. SHIFT [DOWN])Affiche, modifie ou efface des variables d'environnement. SET [variable[=][chaine]] variable Indique le nom de la variable d'environnement. chaine Indique une srie de caractres assigner la variable. Taper SET sans paramtres pour afficher les variables d'environnement courantes. Lance une commande. START commande commande Indique la commande lancer. Pour le moment toutes les commandes sont lances de faon asynchrone. Change le titre de la fentre de l'invite de commandes. TITLE [chaine] chaine Indique le titre de la fentre de l'invite de commandes.Visualizza un messaggio e restituisce la risposta dell'utente MSGBOX tipo ['titolo'] messaggio tipo bottone visualizzato i valori possibili sono: OK, OKCANCEL, YESNO, YESNOCANCEL titolo titolo della finestra di dialogo messaggio testo visualizzato ERRORLEVEL assume il valore in funzione del bottone premuto: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 ,Visualizza o imposta i percorsi di ricerca per gli eseguibili. PATH [[disco:][percorso[;...]] PATH ; Usa PATH ; per rimuovere tutti i percorsi di ricerca e indicare all'interprete dei comandi di cercare solo nella cartella corrente PATH senza parametri visualizza i percorsi attualmente impostati. Ferma l'esecuzione del batch e mostra il seguente messaggio: 'Premi un tasto per continuare...' o il messaggio indicato. PAUSE [messaggio]Modifica il messaggio di pronto a eseguire comandi. PROMPT [testo] testo Indica il nuovo messaggio. Pu essere composto da un testo qualunque e dai seguenti codici speciali: $A & (E commerciale) $B | (pipe) $C ( (parentesi sinistra) $D Data attuale $E Codice del carattere Escape (ASCII code 27) $F ) (parentesi destra) $G > (simbolo di maggiore di) $H Backspace (cancella il carattere precedente) $L < (simbolo di minore di) $N Disco corrente $P Disco e percorso corrente $Q = (simbolo di uguale) $T Ora attuale $V Versione del sistema operativo $_ CR LF (a capo) $$ $ (simbolo dollaro) > $+ Mostra la profondit attuale dello stack delle cartelle< Usa PROMPT senza parametri per attivare quello predefinito.-Inizia una linea di commento. REM [Commento]Rinomina file/cartella or file/cartelle. RENAME [/E /N /P /Q /S /T] vecchio_nome ... nuovo_nome REN [/E /N /P /Q /S /T] vecchio_nome ... nuovo_nome /E Nessun messaggio di errore. /N Nulla. /P Chiede conferma per ogni file. (Non implementato!) /Q Silente. /S Rinomina le sottocartelle. /T Visualizza il numero totale di file rinominati. Non possibile indicare un nuovo disco o percorso nella destinazione. Usare il comando MOVE.  %lu file rinominato  %lu files rinominati Cancella una cartella. RMDIR [disco:]percorso RD [disco:]percorso /S cancella tutti i file e le cartelle indicate /Q non chiede conferma muove il cursore e opzionalmente stampa del testo SCREEN riga colonna [testo] riga riga a cui portare il cursore colonna colonna a cui portare il cursore<Cambia la posizione dei parametri in un batch. SHIFT [DOWN]Visualizza, assegna o rimuove le variabili di ambiente. SET [variabile[=][stringa]] variabile Indica il nome della variabile. stringa Indica il testo da assegnare alla variabile. Usa SET senza parametri per visualizzare le variabili attuali. Attiva un comando. START comando comando Indica il comando da eseguire. Al momento tutti i comandi sono attivati in modo asincrono. `Assegna il titolo per la finestra dei comandi. TITLE [stringa] stringa Indica il titolo. vis en meldingsboks og returner brukers svar MSGBOX type ['tittel'] melding type knapp vises mulige verdier er: OK, OKCANCEL, YESNO, YESNOCANCEL tittel tittel p meldingsboks melding tekst som vises i meldingsboks ERRORLEVEL settes avhengig av hvilken knapp som trykkes: JA : 10 | NEI : 11 OK : 10 | AVBRYT : 12 Viser eller setter en skesti for kjrbare filer. PATH [[stasjon:]mappe[;...]] PATH ; Skriv PATH; for tmme alle skemapper innstillinger og angi at kommandoskallet kun skal ske gjeldende mappe. Skriv PATH uten parameter for vise gjeldende skesti. Stopp eksekvering av satsvis fil og vis flgende melding: 'Trykk en tast for fortsette...' eller en bruker definert melding. PAUSE [melding]jEndre kommandoledetekst. PROMPT [tekst] tekst Spesifisere en nytt kommandoledetekst. Ledeteksten kan bli satt sammen av normale tegn og flgende spesielle koder: $A & (og-tegnet) $B | (loddrett strek) $C ( (venstreparentes) $D gjeldende dato $E Escape-kode (ASCII kode 27) $F ) (Hyreparentes) $G > (strre-enn symbol) $H Tilbake (sletter forrige tegn) $L < (mindre-enn symbol) $N Gjeldende stasjon $P Gjeldende stasjon og mappe $Q = (likhetstegn) $T Gjeldende klokkeslett $V Versjonsnummer for ReactOS $_ Retur og linjeskift $$ $ (dollar tegn) * $+ Vis gjeldende dybde av mappestakken7 Skriv PROMPT uten parameter for resette ledeteksten.:Start en kommentarlinje i en satsvis fil. REM [Kommentar]Endre navn p fil/mappe eller filer/mapper. ENDRE NAVN [/E /N /P /Q /S /T] gammelt_navn ... nytt_navn REN [/E /N /P /Q /S /T] gammelt_navn ... nytt_navn /E Ingen feilmeldinger. /N Ingenting. /P sprsml om godkjenning fr endring av navn p hver fil. (Ikke implementert enda!) /Q Stille. /S Endre navn p undermappe. /T Vis totalt antall endrede filer. NB; du kan ikke spesifisere en ny destinasjon for filen/mappen. Bruk MOVE kommando for det formlet.  %lu fil endret navn  %lu filer endret navn Flytter en mappe. RMDIR [stasjon:]mappe RD [stasjon:]mappe /S Sletter alle filer og mapper innenfor mlet /Q Ikke spr fr sletting. flytt markr og potensielt skriv ut tekst SCREEN rad kol [tekst] rad rad markr flyttes til kol kolonne markr flyttes tilGEndre posisjon for erstattelig parameter i et satsvis fil. SHIFT [NED]Vis, sett, eller fjern miljvariabel. SET [variabel[=][streng]] variabel Spesifisere miljvariabel navn. string Spesifisere en serie av tegn til bestemme variabel. Skriv SET uten parameter for vise gjeldende miljvariabler. Start en kommando. START kommando kommando Spesifisere kommando for kjre. NB; for yeblikket blir alle kommandoer startet asynkront. qVelg vindustittel for kommandotolkvindu. TITLE [streng] streng Spesifisere tittel for kommandotolkvindu. display a message box and return user responce MSGBOX type ['title'] prompt type button displayed possible values are: OK, OKCANCEL, YESNO, YESNOCANCEL title title of message box prompt text displayed by the message box ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Displays or sets a search path for executable files. PATH [[drive:]path[;...]] PATH ; Type PATH ; to clear all search-path settings and direct the command shell to search only in the current directory. Type PATH without parameters to display the current path. Stops the execution of a batch file and shows the following message: 'Press any key to continue...' or a user defined message. PAUSE [message]NChanges the command prompt. PROMPT [text] text Specifies a new command prompt. Prompt can be made up of normal characters and the following special codes: $A & (Ampersand) $B | (pipe) $C ( (Left parenthesis) $D Current date $E Escape code (ASCII code 27) $F ) (Right parenthesis) $G > (greater-than sign) $H Backspace (erases previous character) $L < (less-than sign) $N Current drive $P Current drive and path $Q = (equal sign) $T Current time $V OS version number $_ Carriage return and linefeed $$ $ (dollar sign) 8 $+ Displays the current depth of the directory stackK Type PROMPT without parameters to reset the prompt to the default setting.5Starts a comment line in a batch file. REM [Comment]Renames a file/directory or files/directories. RENAME [/E /N /P /Q /S /T] old_name ... new_name REN [/E /N /P /Q /S /T] old_name ... new_name /E No error messages. /N Nothing. /P Prompts for confirmation before renaming each file. (Not implemented yet!) /Q Quiet. /S Rename subdirectories. /T Display total number of renamed files. Note that you cannot specify a new drive or path for your destination. Use the MOVE command for that purpose.  %lu file renamed  %lu files renamed Removes a directory. RMDIR [drive:]path RD [drive:]path /S Deletes all files and folders within target /Q Doesnt prompt for user move cursor and optionally print text SCREEN row col [text] row row to which move the cursor col column to which move the cursorMChanges the position of replaceable parameters in a batch file. SHIFT [DOWN]Displays, sets, or removes environment variables. SET [variable[=][string]] variable Specifies the environment-variable name. string Specifies a series of characters to assign to the variable. Type SET without parameters to display the current environment variables.            . START       . At the moment all commands are started asynchronously. Sets the window title for the command prompt window. TITLE [string] string Specifies the title for the command prompt window. display a message box and return user responce MSGBOX type ['title'] prompt type button displayed possible values are: OK, OKCANCEL, YESNO, YESNOCANCEL title title of message box prompt text displayed by the message box ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Displays or sets a search path for executable files. PATH [[drive:]path[;...]] PATH ; Type PATH ; to clear all search-path settings and direct the command shell to search only in the current directory. Type PATH without parameters to display the current path. Stops the execution of a batch file and shows the following message: 'Press any key to continue...' or a user defined message. PAUSE [message]NChanges the command prompt. PROMPT [text] text Specifies a new command prompt. Prompt can be made up of normal characters and the following special codes: $A & (Ampersand) $B | (pipe) $C ( (Left parenthesis) $D Current date $E Escape code (ASCII code 27) $F ) (Right parenthesis) $G > (greater-than sign) $H Backspace (erases previous character) $L < (less-than sign) $N Current drive $P Current drive and path $Q = (equal sign) $T Current time $V OS version number $_ Carriage return and linefeed $$ $ (dollar sign) 8 $+ Displays the current depth of the directory stackK Type PROMPT without parameters to reset the prompt to the default setting.5Starts a comment line in a batch file. REM [Comment]Renames a file/directory or files/directories. RENAME [/E /N /P /Q /S /T] old_name ... new_name REN [/E /N /P /Q /S /T] old_name ... new_name /E No error messages. /N Nothing. /P Prompts for confirmation before renaming each file. (Not implemented yet!) /Q Quiet. /S Rename subdirectories. /T Display total number of renamed files. Note that you cannot specify a new drive or path for your destination. Use the MOVE command for that purpose.  %lu file renamed  %lu files renamed Removes a directory. RMDIR [drive:]path RD [drive:]path /S Deletes all files and folders within target /Q Doesnt prompt for user move cursor and optionally print text SCREEN row col [text] row row to which move the cursor col column to which move the cursorMChanges the position of replaceable parameters in a batch file. SHIFT [DOWN]Displays, sets, or removes environment variables. SET [variable[=][string]] variable Specifies the environment-variable name. string Specifies a series of characters to assign to the variable. Type SET without parameters to display the current environment variables. Starts a command. START command command Specifies the command to run. At the moment all commands are started asynchronously. Sets the window title for the command prompt window. TITLE [string] string Specifies the title for the command prompt window. display a message box and return user responce MSGBOX type ['title'] prompt type button displayed possible values are: OK, OKCANCEL, YESNO, YESNOCANCEL title title of message box prompt text displayed by the message box ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Megjelenti vagy belltja a keressi tvonalakat. PATH [[meghajt:]elrsi_t[;...]] PATH ; Keressi tvonalak trlse A PATH trlshez a kvetkezQt rd be: PATH ; gy csak az aktulis mappban fog keresni a CMD.Paramterek nlkl az rvnyes keressi tvonalakat mutatja meg. Felfggeszti a futst, s vr a felhasznlra. A kvetkezQ zenet jelenik meg: 'A folytatshoz nyomj meg egy billentyqt . . .' vagy egy ltalad vlasztott zenet. PAUSE [message] Parancssor belltsa. PROMPT [szveg] szveg Az j parancssor megadsa. A parancssor specilis kdokat is tartalmazhat: $A & (s jel) $B | (csQ) $C ( (kezdQ rzjel) $D Aktulis dtum $E Escape-kd (ASCII 27-es kd) $F ) (zr zrjel) $G > ('nagyobb' jel) $H Trls (eltte lvQ karaktert trli) $L < ('kissebb' jel) $N Aktulis meghajt $P Aktulis meghajt s mappa $Q = (egyenlQsg jel) $T Aktulis idQ $V OS verziszm $_ jsor $$ $ (dollr jel) 8 $+ Displays the current depth of the directory stack[ Ha paramter nlkl berod a PROMPT parancsot, vissza ll az alaprtelmezettre a kijelzs.9Megjegyzst jellQ sor batch fjlokban. REM [megjegyzs]tnevez egy llomnyt. RENAME [/E /N /P /Q /S /T] rgi_nv ... j_nv REN [/E /N /P /Q /S /T] rgi_nv ... j_nv /E Hibazenetek elrejtse. /N Ne csinljon semmit . /P Minden llomnynl rkrdez. (Mg NEM mqkdik!!) /Q Csendes mqkds. /S Almappkat is tnevez. /T sszes tnevezett fjl s llomny. Csak az aktulis meghajtn s mappban fog mqkdni. Ha ez nem elg, hasznld a MOVE parancsot. %lu llomny tnevezve  %lu llomny tnevezve KEltvolt egy mappt. RMDIR [meghajt:]elrsi_t RD [meghajt:]elrsi_tMegvltoztatja a kurzos pozcijt, vagy megjelent adott pozciban egy szveget. SCREEN sor oszlop [szveg] sor Ugrs sora oszlop Ugrs oszlopaSEltolja a helyettesthetQ paramterek pozcijt a batch llomnyban. SHIFT [DOWN]Megjelenti vagy belltja a krnyezeti vltozkat. SET [vltoz[=][rtk]] vltoz Krnyezeti vltoz neve. rtk A belltand rtk. Paramterek nlkl megjelenti az sszes krnyezetivltozt. Vgrehajt egy parancsot. START parancs parancs Vgrehajtja a megadott parancsot. Jelenleg minden parancs aszinkron hajtdik vgre. nBelltja az ablak cmsornak szvegt. TITLE [szveg] szveg Belltja az ablak cmsornak szvegt. ?00000 00000h:yW000000k0ԏT{0Bl0~0Y00 MSGBOX 000 ['0000'] 00000 000 h:yU000000n0000g0Y00 !kn0$PL0O(ug0M0~0Y0: OK, OKCANCEL, YESNO, YESNOCANCEL 0000 00000 0000n00000g0Y00 00000 00000 0000k0h:yU00000000g0Y00 bU00_0000k0000!kn0 ERRORLEVEL L0-[U00~0Y0: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 [LS0000n0i"}000h:y~0_0o0-[W0~0Y00 PATH [[0000:]00[;...]] PATH ; 00000h0W0f0 ; (00000) `0Q00c[Y00h00Y0y0f0n0i"}00o0 000U00f0s(Wn0000000`0Q0L0i"}U00~0Y00 000000c[[0Z0k0 PATH h0eQRY00h00s(Wn000L0h:yU00~0Y00 ]000 00000n0Qt0NBf\PbkW00!kn0000000h:yW0~0Y00: '}LY00k0o0UOK0000bW0f0O0`0U0D0 ...' ~0_0o00000L0[W0_0000000 PAUSE [00000]0000 000000 YfW0~0Y00 PROMPT [eW[R] eW[R eW0D00000 000000c[W0~0Y00 PROMPT k0o08^n0eW[h0!kk0:yY0yrk0000O(ug0M0~0Y0: $A & (000000) $B | (000) $C ( (]K0c0S0) $D s(Wn0eN $E 00000 000 (ASCII 000n0 27) $F ) (SK0c0S0) $G > ( NI{S ('Yj00)) $H 0000000 (vMRn0eW[0JRdW0~0Y0) $L < ( NI{S (\j00)) $N s(Wn00000 $P s(Wn00000h000 $Q = (I{S) $T s(Wn0Bf;R $V OS n000000juS $_ 00000 0000h00000000 $$ $ (00S)  $+ s(Wn0000000 0000n0mU00h:yW0~0Y03 000000c[[0Z0k0 PROMPT h0eQRY00h0000000n0-[L000000k00000U00~0Y00&000 0000k00000 (lȑ) 02W0~0Y00 REM [0000]e00000000000 (peS) n0 TMR0 YfW0~0Y00 RENAME [/E /N /P /Q /S /T] CQn00000 T ... e0000 T REN [/E /N /P /Q /S /T] CQn00000 T ... e0000 T /E 000000000h:yW0~0[000 /N UO0W0~0[000 /P 0000n0 TMR0 YfY00MRk0]00^00x0Bl0~0Y00 (~0`0[ňU00f0D0~0[00!) /Q Quiet. /S 00000000n0 TMR0 YfY000 /T TMR0 YfW0_00000n0}pe01XJTY000 e0000 T k0o0eW0D000000000c[g0M0j0D0n0g0laW0f0O0`0U0D00 ]0F0D0c0_0vvk0o0 MOVE 00000(uD0f0O0`0U0D00  %lu Pn00000n0 TMRL0 YfU00~0W0_0  %lu Pn00000n0 TMRL0 YfU00~0W0_0 p0000000JRdW0~0Y00 RMDIR [0000:]00 RD [0000:]00 /S c[U00_0000000Qk0B000000000000Y0y0f0JRdW0~0Y00 /Q xn0000000h:yW0~0[000 j00000yRU0[0~0Y00yR_0eW[R0eQRY00S0h00g0M0~0Y00 SCREEN R L [0000] R 00000yRU0[00Rg0Y00 L 00000yRU0[00Lg0Y00.000 0000-Nn0nM0cH0Sj000000n0MOn0 YfW0~0Y00 SHIFT [DOWN]tX Ype0h:y0-[0~0_0o0JRdW0~0Y00 SET [ Ype T[=]eW[R]] Ype T tX Ype T0c[W0~0Y00 eW[R Ypek0rR0S_f00eW[R0c[W0~0Y00 s(Wn0tX Ype0h:yY00k0o00000000c[[0Z0k0 SET h0eQRW0f0O0`0U0D00 g%Rn0000000wRW00c[W0_000000~0_0o000000[LW0~0Y00 START 0000 0000 [LY0000000c[W0~0Y00 sBfpg0o000000o0Y0y0f0 Tg[0Z0k0YU00~0Y00 X0000 00000 00000n000000 00000-[W0~0Y00 TITLE [eW[R] eW[R 0000 00000 00000n000000c[W0~0Y00 Wy[wietla okno dialogowe i zwraca odpowiedz u|ytkownika MSGBOX typ ['tytuB'] tekst typ Rodzaj okna dialogowego mo|liwe okna: OK, OKCANCEL, YESNO, YESNOCANCEL tytuB TytuB okna dialogowego tekst Tekst wy[wietlony w oknie dialogowym Warto[ ERRORLEVEL wynosi zale|nie od naci[nitego przycisku: TAK : 10 | NIE : 11 OK : 10 | ANULUJ : 12 .Wy[wietla lub ustawia [cie|k dostpu dla programw. PATH [[napd:][cie|ka[;...]] PATH ; Wpisz PATH ; je[li chcesz wyczy[ci wszystkie zapisane [cie|ki dostpu i zmusi konsol do przeszukiwania wyBcznie katalogu bie|cego. Wpisz PATH bez |adnych parametrw, by wy[wietli zapisane [cie|ki dostpu. Zatrzymuje wykonywanie programu wsadowego i pokazuje wiadomo[: 'Naci[nij dowolny klawisz, aby kontynuowa...' albo inn dowoln. PAUSE [wiadomo[] Zmienia znak zachty. PROMPT [tekst] tekst Definiuje nowy znak zachty. Znak zachty mo|e skBada si z normalnych znakw, a tak|e poni|szych symboli: $A & (Et) $B | $C ( (lewy nawias) $D Bie|ca data $E Znak ucieczki (kod ASCII 27) $F ) (prawy nawias) $G > (znak wikszo[ci) $H (usuwa ostatni znak) $L < (znak mniejszo[ci) $N Bie|cy napd $P Bie|cy napd i [cie|ka $Q = (znak rwno[ci) $T Bie|cy czas $V Wersja systemu $_ Znak CR/LF $$ $ (dolar) . $+ Wy[wietla obecny poziom stosu katalogwI Wpisz PROMPT bez |adnych parametrw, by powrci do ustawieD domy[lnych.=Definiuje lini komentarza w pliku wsadowym. REM [komentarz]Zmienia nazw pliku/katalogu (tak|e wielu). RENAME [/E /N /P /Q /S /T] stara_nazwa ... nowa_nazwa REN [/E /N /P /Q /S /T] stara_nazwa ... nowa_nazwa /E Bez komunikatw o bBdach. /N Nic. /P Wy[wietla pro[b o potwierdzenie przed ka|dym plikiem/katalogiem. (nie jest jeszcze zaimplementowane) /Q Tryb cichy. /S Zmienia tak|e nazwy podkatalogw. /T Wy[wietla podsumowanie ilo[ci zmienionych nazw. Uwaga: mo|esz rwnie| poda now [cie|k dostpu dla zmienionych plikw. U|yj do tego komendy MOVE.  zmieniono nazw %lu pliku  zmieniono nazwy %lu plikw Usuwa katalog. RMDIR [napd:][cie|ka RD [napd:][cie|ka /S Kasuje tak|e wszystkie pliki i podkatalogi w danym katalogu /Q Nie wy[wietla pro[by o potwierdzenie Przesuwa kursor i opcjonalnie wy[wietla tekst SCREEN rzd kolumna [tekst] rzd numer rzdu, do ktrego zostanie przesunity kursor kolumna numer kolumny, do ktrej zostanie przesunity kursor9Zmienia pozycj parametru w pliku wsadowym. SHIFT [DOWN]Wy[wietla, ustawia lub usuwa zmienne [rodowiskowe. SET [zmienna[=][parametry]] zmienna Okre[la nazw zmiennej [rodowiskowej. parametry Okre[la parametry przypisane do tej zmiennej. Wpisz SET bez |adnych parametrw, by wy[wietli obecne ustawienia zmiennych. WywoBuje komend. START komenda komenda Okre[la komend, jaka ma by wywoBana. Obecnie wszystkie komendy s uruchamiane asynchronicznie. _Ustawia tytuB dla okna ze znakiem zachty. TITLE [tytuB] tytuB Okre[la tytuB dla okna. K2>4 >:=0 A A>>1I5=85< 8 2>72@0B >B25B0 ?>;L7>20B5;O MSGBOX B8? ['703>;>2>:'] ?>4A:07:0 B8? 2K2>48<K5 :=>?:8 2>7<>6=K5 7=0G5=8O: OK, OKCANCEL, YESNO, YESNOCANCEL 703>;>2>: 703>;>2>: >:=0 A A>>1I5=85< ?>4A:07:0 2K2>48<K9 B5:AB ?>4A:07:8 ERRORLEVEL CAB0=02;8205BAO 2 A>>B25BAB288 A =060B>9 :=>?:>9: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 K2>4 8;8 7040=85 ?CB8 ?>8A:0 8A?>;=O5<KE D09;>2. PATH [[48A::]?CBL[;...]] PATH ; ><0=40 PATH ; >G8I05B ?CBL ?>8A:0 8A?>;L7C5<KE D09;>2, >3@0=8G82 53> B5:CI8< :0B0;>3><. ><0=40 PATH 157 ?0@0<5B@>2 >B>1@0605B B5:CI89 ?CBL ?>8A:0. @8>AB0=>2:0 2K?>;=5=8O ?0:5B=>3> D09;0 8 2K2>4 A>>1I5=8O: ';O ?@>4>;65=8O =06<8B5 ;N1CN :;028HC...' 8;8 C:070==>5 A>>1I5=85. PAUSE [A>>1I5=85]m7<5=5=85 ?@83;0H5=8O :><0=4=>9 AB@>:8. PROMPT [B5:AB] B5:AB >2>5 ?@83;0H5=85 :><0=4=>9 AB@>:8. @83;0H5=85 <>65B 2:;NG0BL >1KG=K5 A8<2>;K 8 A;54CNI85 :>4K: $A & (0<?5@A0=4) $B | (25@B8:0;L=0O G5@B0) $C ( (;520O :@C3;0O A:>1:0) $D "5:CI0O 40B0 $E ESC (A8<2>; ASCII A :>4>< 27) $F ) (?@020O :@C3;0O A:>1:0) $G > (7=0: "1>;LH5") $H BACKSPACE (C40;5=85 ?@54K4CI53> A8<2>;0) $L < (7=0: "<5=LH5") $N "5:CI89 48A: $P "5:CI85 48A: 8 :0B0;>3 $Q = (7=0: @025=AB20) $T "5:CI55 2@5<O $V ><5@ 25@A88 >?5@0F8>==>9 A8AB5<K $_ 5@52>4 AB@>:8 $$ $ (7=0: 4>;;0@0) 8 $+ Displays the current depth of the directory stackO PROMPT 157 ?0@0<5B@>2 CAB0=02;8205B ?@83;0H5=85 :><0=4=>9 AB@>:8 ?> C<>;G0=8N.;><5I5=85 :><<5=B0@852 2 ?0:5B=K5 D09;K. REM [:><<5=B0@89]5@58<5=>20=85 >4=>3> 8;8 =5A:>;L:8E D09;>2 8;8 :0B0;>3>2. RENAME [/E /N /P /Q /S /T] AB0@>5_8<O ... =>2>5_8<O REN [/E /N /P /Q /S /T] AB0@>5_8<O ... =>2>5_8<O /E 5 2K2>48BL A>>1I5=8O >1 >H81:0E. /N Nothing. /P 0?@>A ?>4B25@645=8O ?5@54 ?5@58<5=>20=85<. (5 @50;87>20=> 2 40==K9 <><5=B!) /Q Quiet. /S 5@58<5=>2K20BL ?>4:0B0;>38. /T K2>4 :>;8G5AB20 ?5@58<5=>20==KE D09;>2. ;O :>=5G=>3> D09;0 =5;L7O C:070BL 4@C3>9 48A: 8;8 :0B0;>3. ;O MB>9 F5;8 A;54C5B 8A?>;L7>20BL :><0=4C MOVE.  %lu D09; ?5@58<5=>20=  %lu D09;>2 ?5@58<5=>20=> z#40;5=85 :0B0;>30. RMDIR [48A::]?CBL RD [48A::]?CBL /S #40;5=85 45@520 :0B0;>3>2 /Q B:;NG5=85 70?@>A0 ?>4B25@645=8O 5@5<5I5=85 :C@A>@0 8 2K2>4 B5:AB0 SCREEN AB@ :>; [B5:AB] AB@ AB@>:0, =0 :>B>@CN A;54C5B ?5@5<5AB8BL :C@A>@ :>; :>;>=:0, =0 :>B>@CN A;54C5B ?5@5<5AB8BL :C@A>@Y7<5=5=85 A>45@68<>3> (A4283) ?>4AB02;O5<KE ?0@0<5B@>2 4;O ?0:5B=>3> D09;0. SHIFT [DOWN]K2>4, 7040=85 8 C40;5=85 ?5@5<5==KE A@54K. SET [?5@5<5==0O[=][7=0G5=85]] ?5@5<5==0O <O ?5@5<5==>9 A@54K. 7=0G5=85 !B@>:0 A8<2>;>2, ?@8A208205<0O C:070==>9 ?5@5<5==>9. SET 157 ?0@0<5B@>2 2K2>48B B5:CI85 7=0G5=8O ?5@5<5==KE A@54K. 0?CA: C:070==>9 ?@>3@0<<K 8;8 :><0=4K. START :><0=40 :><0=40 ><0=40 8;8 ?@>3@0<<0 4;O 70?CA:0. At the moment all commands are started asynchronously. r7<5=5=85 703>;>2:0 >:=0 :><0=4=>9 AB@>:8. TITLE [AB@>:0] AB@>:0 C4CI89 703>;>2>: >:=0 :><0=4=>9 AB@>:8. display a message box and return user responce MSGBOX type ['title'] prompt type button displayed possible values are: OK, OKCANCEL, YESNO, YESNOCANCEL title title of message box prompt text displayed by the message box ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Displays or sets a search path for executable files. PATH [[drive:]path[;...]] PATH ; Type PATH ; to clear all search-path settings and direct the command shell to search only in the current directory. Type PATH without parameters to display the current path. Stops the execution of a batch file and shows the following message: 'Pokra ujte stla enm >ubovo>nho klvesu ...' or a user defined message. PAUSE [message]XChanges the command prompt. PROMPT [text] text Specifies a new command prompt. Prompt can be made up of normal characters and the following special codes: $A & (Ampersand) $B | (pipe) $C ( (=av okrhla ztvorka) $D Aktulny dtum $E Escape code (ASCII code 27) $F ) (Prav okrhla ztvorka) $G > (greater-than sign) $H Backspace (erases previous character) $L < (less-than sign) $N Current drive $P Current drive and path $Q = (equal sign) $T Aktulny as $V slo verzie OS $_ Carriage return and linefeed $$ $ (znak dolra) 8 $+ Displays the current depth of the directory stackK Type PROMPT without parameters to reset the prompt to the default setting.5Starts a comment line in a batch file. REM [Comment]Renames a file/directory or files/directories. RENAME [/E /N /P /Q /S /T] old_name ... new_name REN [/E /N /P /Q /S /T] old_name ... new_name /E No error messages. /N Nothing. /P Prompts for confirmation before renaming each file. (Not implemented yet!) /Q Quiet. /S Rename subdirectories. /T Display total number of renamed files. Note that you cannot specify a new drive or path for your destination. Use the MOVE command for that purpose.  %lu file renamed  %lu files renamed Removes a directory. RMDIR [drive:]path RD [drive:]path /S Deletes all files and folders within target /Q Doesnt prompt for user move cursor and optionally print text SCREEN row col [text] row row to which move the cursor col column to which move the cursorMChanges the position of replaceable parameters in a batch file. SHIFT [DOWN]Displays, sets, or removes environment variables. SET [variable[=][string]] variable Specifies the environment-variable name. string Specifies a series of characters to assign to the variable. Type SET without parameters to display the current environment variables. Starts a command. START command command Specifies the command to run. At the moment all commands are started asynchronously. Sets the window title for the command prompt window. TITLE [string] string Specifies the title for the command prompt window. menampilkan kotak pesan dan menghasilkan respon pengguna MSGBOX type ['title'] prompt type tombol ditampilkan nilai yang mungkin adalah: OK, OKCANCEL, YESNO, YESNOCANCEL title judul kotak pesan prompt teks ditampilkan dengan kotak pesan ERRORLEVEL disetel berdasarkan tombol yang ditekan: YA : 10 | TIDAK : 11 OK : 10 | BATAL : 12 &Menampilkan atau menyetel path pencarian untuk file executable. PATH [[drive:]path[;...]] PATH ; Ketik PATH ; untuk membersihkan semua setelan path-pencarian dan shell perintah langsung untuk mencari hanya dalam direktori saat ini. Ketik PATH tanpa parameter untuk menampilkan path saat ini. Menunda eksekusi file batch dan menampilkan pesan berikut: 'Tekan tombol untuk melanjutkan...' atau pesan yang dibuat pengguna. PAUSE [pesan]UMengubah prompt perintah. PROMPT [teks] teks Menetapkan prompt perintah baru. Prompt bisa dibuat dari karakter normal dan kode spesial berikut: $A & (Ampersand) $B | (pipe) $C ( (Tanda kurung Kiri) $D Tanggal saat ini $E Kode Escape (ASCII code 27) $F ) (Tanda kurung Kanan) $G > (Tanda lebih-dari) $H Backspace (menghapus karakter sebelumnya) $L < (tanda kurang-dari) $N Drive saat ini $P Drive dan path saat ini $Q = (tanda sama dengan) $T Jam saat ini $V Nomor versi OS $_ Carriage return dan linefeed $$ $ (tanda dolar) 8 $+ Menampilkan kedalaman tumpukan direktori saat iniF Ketik PROMPT tanpa parameter untuk mereset prompt ke setelan standar.8Memulai baris komentar dalam file batch. REM [Komentar]Mengganti nama file/direktori. RENAME [/E /N /P /Q /S /T] nama_lama ... nama_baru REN [/E /N /P /Q /S /T] nama_lama ... nama_baru /E Tidak ada pesan. /N Tidak. /P Menanyakan konfirmasi sebelum mengganti nama setiap file. (Belum diimplementasikan!) /Q Diam-diam. /S Mengganti nama subdirektori. /T Menampilkan jumlah total dari file yang diganti nama. Catatan bahwa anda tidak bisa menetapkan drive baru atau path untuk tujuan anda. Gunakan perintah MOVE untuk keperluan itu.  %lu file diganti nama  %lu file diganti nama Menghapus direktori. RMDIR [drive:]path RD [drive:]path /S Menghapus semua file dan folder di dalam target /Q Tidak bertanya pada pengguna memindahkan kursor dan secara opsional mencetak teks SCREEN row col [text] row baris ke mana kursor dipindahkan col kolom ke mana kursor dipindahkanKMengubah posisi parameter yang bisa diganti dalam file batch. SHIFT [DOWN]Menampilkan, menyetel, atau menghapus variabel lingkungan. SET [variable[=][string]] variable Menetapkan nama variabel-lingkungan. string Menetapkan deretan karakter untuk ditempatkan ke variabel. Ketik SET tanpa parameter untuk menampilkan variabel lingkungan sekarang. Memulai sebuah perintah. START command command Menetapkab perintah yang dilaksanakan. Untuk saat ini semua perintah dimulai secara asinkronos. Menyetel judul jendela untuk jendela prompt perintah. TITLE [string] string Menetapkan judul untuk jendela prompt perintah. display a message box and return user responce MSGBOX type ['title'] prompt type button displayed possible values are: OK, OKCANCEL, YESNO, YESNOCANCEL title title of message box prompt text displayed by the message box ERRORLEVEL is set according the button pressed: YES : 10 | NO : 11 OK : 10 | CANCEL : 12 Displays or sets a search path for executable files. PATH [[drive:]path[;...]] PATH ; Type PATH ; to clear all search-path settings and direct the command shell to search only in the current directory. Type PATH without parameters to display the current path. Stops the execution of a batch file and shows the following message: 'Press any key to continue...' or a user defined message. PAUSE [message]NChanges the command prompt. PROMPT [text] text Specifies a new command prompt. Prompt can be made up of normal characters and the following special codes: $A & (Ampersand) $B | (pipe) $C ( (Left parenthesis) $D Current date $E Escape code (ASCII code 27) $F ) (Right parenthesis) $G > (greater-than sign) $H Backspace (erases previous character) $L < (less-than sign) $N Current drive $P Current drive and path $Q = (equal sign) $T Current time $V OS version number $_ Carriage return and linefeed $$ $ (dollar sign) 8 $+ Displays the current depth of the directory stackK Type PROMPT without parameters to reset the prompt to the default setting.5Starts a comment line in a batch file. REM [Comment]Renames a file/directory or files/directories. RENAME [/E /N /P /Q /S /T] old_name ... new_name REN [/E /N /P /Q /S /T] old_name ... new_name /E No error messages. /N Nothing. /P Prompts for confirmation before renaming each file. (Not implemented yet!) /Q Quiet. /S Rename subdirectories. /T Display total number of renamed files. Note that you cannot specify a new drive or path for your destination. Use the MOVE command for that purpose.  %lu file renamed  %lu files renamed Removes a directory. RMDIR [drive:]path RD [drive:]path /S Deletes all files and folders within target /Q Doesnt prompt for user move cursor and optionally print text SCREEN row col [text] row row to which move the cursor col column to which move the cursorMChanges the position of replaceable parameters in a batch file. SHIFT [DOWN]Displays, sets, or removes environment variables. SET [variable[=][string]] variable Specifies the environment-variable name. string Specifies a series of characters to assign to the variable. Type SET without parameters to display the current environment variables. Starts a command. START command command Specifies the command to run. At the moment all commands are started asynchronously. Sets the window title for the command prompt window. TITLE [string] string Specifies the title for the command prompt window. Stellt die Systemzeit oder zeigt sie an. TIME [/T][Zeit] /T nur anzeigen TIME ohne Parameter zeigt die aktuelle Systemzeit an und fragt nach der neuen Uhrzeit. Drcken Sie die EINGABETASTE, um die bisherige Zeit beizubehalten.Geben Sie eine neue Zeit ein: Verstrichene %d Millisekunden $Verstrichene %02d%c%02d%c%02d%c%02d PErlaubt die Benutzung von 10 Stoppuhren. TIMER [ON|OFF] [/S] [/n] [/Fn] ON schaltet die Stoppuhr ein OFF schaltet die Stoppuhr aus /S Teilzeit. Sende die Stoppuhr Teil- zeit, ohne den Wert zu verndern /n Anzahl der Stoppuhren gltige Stoppuhren sind 0 bis 9 Standardwert = 1 /Fn Ausgabeformatierung n kann 0 oder 1 sein: 0 Millisekunden 1 hh%cmm%css%cdd Falls nicht ON, OFF oder /S angegeben wurde wird die Stoppuhr ausgeschalten. UZeigt den Inhalt einer oder mehrerer Textdateien an. TYPE [Laufwerk:][Pfad]DateinameDieser Befehl ist nur eine Atrappe!! Legt fest, ob berwacht werden soll, ob Dateien korrekt auf den Datentrger geschrieben werden. VERIFY [ON | OFF] Der Befehl VERIFY ohne Parameter zeigt die aktuelle Einstellung von VERIFY an.VERIFY ist %s. VERIFY kann nur ON oder OFF seinZeigt Shell Informationen an. VER [/C][/R][/W] /C Zeigt die Credits an. /R Zeigt die Weitergabeinformationen an. /W Zeigt die Garantieerklrung an.< kommt mit absolut keiner Garantie; fr nhere Informationen darber tippen Sie: `ver /W'. Das ist eine freie Software, und Sie knnen die Software unter bestimmten Bedingungen weiter vertreiben; tippen Sie `ver /R' fr nhere Informationen darber. Tippen Sie `ver /C' um die Mitwirkenden (Credits) aufzulisten. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. Senden Sie Bug-Reports an <ros-dev@reactos.org>. Updates sind auf der offiziellen ReactOS-Webseite verfgbar: http://www.reactos.org# FreeDOS Version programmiert von: # ReactOS Version programmiert von: Muestra o cambia la hora del sistema. TIME [/T][hora] /T Slo la muestra Escribe TIME sin parmetros para mostrar la hora actual y preguntar por una nueva. Pulsa INTRO para mantener la misma hora. Introduce la nueva hora: Transcurridos %d msecs %Transcurridos %02d%c%02d%c%02d%c%02d Permite al usuario el uso de diez paradas de reloj. TIMER [ON|OFF] [/S] [/n] [/Fn] ON Cambia la parada a ON OFF Cambia la parada a OFF /S Divide el tiempo. Devuelve una division de la parada del reloj sin cambiar su valor. /n Especifica el nmero de la parada de reloj. Las paradas de reloj disponibles son de 0 a 9 Si no se especifica el valor por defecto es 1 /Fn Formato de salida n puede ser: 0 millisegundos 1 hh%cmm%css%cdd Si ni ON, OFF o /S se especifican, el comando cambiara el estado de parada del reloj Muestra los contenidos de un archivo de texto. TYPE [unidad:][ruta]archivo /P Muestra slo una pantalla de salida cada vez. Este comando es solo de relleno!! Configura si hay que verificar que los archivos se and escrito correctamente en un disco. VERIFY [ON | OFF] Escribe VERIFY sin parmetros para mostrar la configuracin actual de VERIFY. VERIFY est %s. Tienes que especificar ON o OFF.Muestra la informacin de la versin del shell VER [/C][/R][/W] /C Muestra los creditos. /R Muestra la informacin de redistribucin. /W Muestra la informacin de la garantia. Este software Viene con ABSOLUTAMENTE NINGUNA GARANTIA; para ms detalles escribe: `ver /w'. Este es un software gratuito, y ests invitado a redistribuirlo bajo ciertas condiciones; escribe `ver /r' para los detalles. Escribe `ver /c' para una lista de los crditos. Este programa es distribuido con la esperanza de que sea til, pero CON NINGUNA GARANTIA; incluso sin la garanta implcita de MERCADERIA o AJUSTE A UN PROPSITO PARTICULAR. Mira la Licencia Pblica General GNU para ms detalles. Este programa es un software gratuito; puedes redistribuirlo y/o modificarlo bajo los trminos de la Licencia Pblica General GNU tal y como establece la Fundacin de Software Libre; tanto en la versin 2 de la Licencia, o (segn tu eleccin) cualquier otra posterior. k Manda los informes de bugs a <ros-dev@reactos.org>. Actualizaciones disponibles en: http://www.reactos.org FreeDOS version escrita por:  ReactOS version escrita por: Affiche ou modifie l'heure systme. TIME [/T][heure] /T affiche seulement Taper TIME sans paramtres pour afficher l'heure courante et une invite pour la modifier. Presser la touche ENTREE pour garder la mme heure.Entrer la nouvelle heure : Ecoul %d msecs Ecoul %02d%c%02d%c%02d%c%02d Permet l'utilisation de dix chronomtres. TIMER [ON|OFF] [/S] [/n] [/Fn] ON Dmarre le chronomtre OFF Stoppe le chronomtre /S Split time. Return stopwach split time without changing its value /n Indique le numro du chronomtre. Les chronomtres disponibles vont de 0 10. Si non spcifi, le chronomtre par dfaut est 1 /Fn Format de sortie n peut tre : 0 millisecondes 1 hh%cmm%css%cdd En l'absence d'une option ON, OFF ou /S la commande changera l'tat du chronomtre slectionn }Affiche le contenu de fichiers textes. TYPE [lecteur:][chemin]nomfich /P Ne montre qu'un cran de contenu la fois. Cette commande ne fait rien !! Spcifie s'il faut verifier que vos fichiers sont crits correctement. VERIFY [ON | OFF] Taper VERIFY sans paramtres pour afficher le rglage de VERIFY.VERIFY est %s. Vous devez indiquer ON ou OFF.Affiche les informations de version du shell VER [/C][/R][/W] /C Affiche les crdits. /R Affiche les informations sur la redistribution. /W Affiche les informations de garantie. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. t Envoyer les rapports d'erreur <ros-dev@reactos.org>. Les mises jour sont disponibles : http://www.reactos.org Version FreeDOS crite par:  Version ReactOS crite par: Visualizza o assegna l'ora di sistema. TIME [/T][ora] /T Visualizza solo Se TIME usato senza parametri viene visualizzata l'ora attuale e richiesta quella nuova. Premere INVIO per non modificarla. Inserisci la nuova ora: Sono trascorsi %d millisecondi &Sono trascorsi %02d%c%02d%c%02d%c%02d dpermette l'uso di dieci cronometri. TIMER [ON|OFF] [/S] [/n] [/Fn] ON attiva il cronometro OFF ferma il cronometro /S tempo parziale. Restituisce il tempo attuale senza fermare il cronometro /n Indica quale cronometro. Sono validi i numeri da 0 a 9 Se non indicato predefinito 1 /Fn tipo di formato n pu essere: 0 millisecondi 1 hh%cmm%css%cdd se non sono indicati ON, OFF o /S verr commutato lo stato del cronometro da attivo a fermo o viceversa yVisualizza il contenuto di un file di testo. TYPE [disco:][percorso]nomefile /P Mostra una schermata alla volta. Questo comando non implementato!! Attiva o disattiva la verifica automatica della scrittura dei file su disco. VERIFY [ON | OFF] Usa VERIFY senza parametri per visualizzare l'impostazione corrente. VERIFY %s. E' necessario indicare ON o OFF.Visualizza la versione dell'interprete dei comandi VER [/C][/R][/W] /C Visualizza i crediti. /R Visualizza le informazioni di redistribuzione. /W Visualizza le informazioni di garanzia. disponibile PRIVO DI OGNI GARANZIA; per i dettagli usare: `ver /w'. Questo software libero, e siete i benvenuti se lo distribuite con alcune condizioni; usare `ver /r' per i dettagli. Usare `ver /c' per un elenco dei crediti. Questo programma e' distribuito con la speranza che possa essere utile, ma PRIVO DI OGNI GARANZIA; senza nemmeno una garanzia implicita di VENDIBILITA o ADEGUATEZZA PER UN PARTICOLARE SCOPO. Vedere la 'GNU General Public License' per ulteriori dettagli. Questo software libero; potete distribuirlo e/o modificarlo nell'ambito della licenza 'GNU General Public License' cos come pubblicata da Free Software Foundation; a scelta la versione 2 della licenza o una qualunque successiva.  Inviare le segnalazioni di anomalie a <ros-dev@reactos.org>. Gli aggiornamenti sono disponibili presso: http://www.reactos.org Versione FreeDOS scritto da:  Versione ReactOS scritto da: Vis eller sett system tid. TIME [/T][tid] /T vis bare Skriv TIME uten parametere for vise gjeldende tidsinnstillinger og et sprsml om en ny en. Trykk ENTER for beholde samme tid. Velg ny tid: Forlpt %d msecs Forlpt %02d%c%02d%c%02d%c%02d fTillater bruk av inntil ti stoppeklokker. TIMER [ON|OFF] [/S] [/n] [/Fn] ON start stoppeklokke OFF stopp stoppeklokke /S Del tiden. Retur stoppeklokke tid uten endre dens verdi /n Spesifisere stoppeklokke nummer. Stoppeklokke er tilgjengelig fra 0 til 9 Hvis ikke det er spesifisert er standard lik 1 /Fn Format for utgende n kan bli: 0 mikrosekunder 1 hh%cmm%css%cdd hvis hverken ON, OFF eller /S er spesifisert vil status for stoppeklokken veksles. eVis innholdet av tekstfiler. Skriv [stasjon:][mappe]filnavn /P Vis en full skjerm om gangen. Denne kommandoen er bare en etterlikning!! Angir om det skal bekreftes at dine filer er skrevet korrekt til disk VERIFY [ON | OFF] Skriv VERIFY uten parametre for vise gjeldende VERIFY innstillinger. VERIFY er %s. M spesifisere ON eller OFF.Vis Reactos versjonen VER [/C][/R][/W] /C Vis anerkjennelse. /R Vis videreformidlingsinformasjon. /W Vis garantiinformasjon. kommer med ABSOLUTT INGEN GARANTI; for detaljer Skriv: `ver /w'. Dette er gratis programvare, og du er velkommen til videreformidle det under gitte betingelser; Skriv `ver /r' for detaljer. Skriv `ver /c' for en liste av anerkjennelser. Dette programet er fordelt i hpet som det vil bli brukbar, men UTEN NOEN GARANTI; uten engang antydet garantid for SALGBARHET eller BRUKBARHET FOR NOE ML. Se GNU Generell Publikum Lisens for flere detaljer. Dette programmet er gratis programvare; du kan videre- formidle det og/eller modifisere det under betingelser av Generell Publikum Lisens som utgivelses av Free Software Foundation; enten versjon 2 av Lisens, eller (ved din mulighet) andre nyere versjon. h Send bug rapporter til <ros-dev@reactos.org>. oppdateringer er tilgjengelig her: http://www.reactos.org FreeDOS versjon skrevet av:  ReactOS versjon skrevet av: Displays or sets the system time. TIME [/T][time] /T display only Type TIME with no parameters to display the current time setting and a prompt for a new one. Press ENTER to keep the same time.   : Elapsed %d msecs Elapsed %02d%c%02d%c%02d%c%02d Fallow the use of ten stopwatches. TIMER [ON|OFF] [/S] [/n] [/Fn] ON set stopwatch ON OFF set stopwatch OFF /S Split time. Return stopwatch split time without changing its value /n Specifiy the stopwatch number. Stopwatches available are 0 to 9 If it is not specified default is 1 /Fn Format for output n can be: 0 milliseconds 1 hh%cmm%css%cdd if none of ON, OFF or /S is specified the command will toggle stopwatch state rDisplays the contents of text files. TYPE [drive:][path]filename /P Shows one screen of output at a time. This command is just a dummy!! Sets whether to verify that your files are written correctly to a disk. VERIFY [ON | OFF] Type VERIFY without a parameter to display the current VERIFY setting. VERIFY is %s. Must specify ON or OFF.     . VER [/C][/R][/W] /C Displays credits. /R Displays redistribution information. /W Displays warranty information. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \ Send bug reports to <ros-dev@reactos.org>. Updates are available at: http://www.reactos.org FreeDOS version written by:  ReactOS version written by: Displays or sets the system time. TIME [/T][time] /T display only Type TIME with no parameters to display the current time setting and a prompt for a new one. Press ENTER to keep the same time. Enter new time: Elapsed %d msecs Elapsed %02d%c%02d%c%02d%c%02d Fallow the use of ten stopwatches. TIMER [ON|OFF] [/S] [/n] [/Fn] ON set stopwatch ON OFF set stopwatch OFF /S Split time. Return stopwatch split time without changing its value /n Specifiy the stopwatch number. Stopwatches available are 0 to 9 If it is not specified default is 1 /Fn Format for output n can be: 0 milliseconds 1 hh%cmm%css%cdd if none of ON, OFF or /S is specified the command will toggle stopwatch state rDisplays the contents of text files. TYPE [drive:][path]filename /P Shows one screen of output at a time. This command is just a dummy!! Sets whether to verify that your files are written correctly to a disk. VERIFY [ON | OFF] Type VERIFY without a parameter to display the current VERIFY setting. VERIFY is %s. Must specify ON or OFF.Displays shell version information VER [/C][/R][/W] /C Displays credits. /R Displays redistribution information. /W Displays warranty information. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \ Send bug reports to <ros-dev@reactos.org>. Updates are available at: http://www.reactos.org FreeDOS version written by:  ReactOS version written by: Megjelenti vagy belltja a rendszeridQt. TIME [/T][idQ] /T Csaj megjelenti Paramterek nlkl megjelenti az aktulis idQt s kr egy jat. Csak egy ENTER megnyomsval nem lltja t. j idQ: Eltelt %d ezred msodperc Eltelt: %02d%c%02d%c%02d%c%02d Jallow the use of ten stopwatches. TIMER [ON|OFF] [/S] [/n] [/Fn] ON Stopper bekapcsolsa OFF Stopper kikapcsolsa /S Split time. Return stopwatch split time without changing its value /n Stopper azonost megadsa. Stopwatches avaliable are 0 to 9 If it is not specified default is 1 /Fn Format for output n can be: 0 milliseconds 1 hh%cmm%css%cdd if none of ON, OFF or /S is specified the command will toggle stopwatch state Megjelenti az llomnyok tartalmt. TYPE [meghajt:][elrsi_t]llomnynv /P Csak egy kpernyQnyi tartalmat jelent meg egyszerre. Ez a parancs mg nem mqkdik!! Lemezre rs utni ellenQrzst lltja be. VERIFY [ON | OFF] rd be a VERIFY-t paramterek nlkl, hogy megjelentse aktulis llapott. Az ellenQrzs jelenleg %s. Csak az ON vagy OFF elfogadott.A ReactOS verziinformciit jelenti meg VER [/C][/R][/W] /C KsztQk nvsora. /R Terjesztsi informcik. /W Jtllsi informcik. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. s Hibkrl E-Maileket ide kldhetsz: <ros-dev@reactos.org>. Frisstsek s egyb informcik: http://www.reactos.org A FreeDOS ksztQi:  A ReactOS ksztQi: 0000Bf;R0h:y~0_0o0-[W0~0Y00 TIME [/T][Bf;R] /T s(WBf;Rn0h:yn00LD0~0Y00 00000n0c[L0j0Q00p00s(Wn0-[L0h:yU000eW0D0Bf;R0eQRg0M00 00000k0j00~0Y00 YfW0j0D04XTo00Enter 000bW0f0O0`0U0D00 eW0D0Bf;R0eQRW0f0O0`0U0D0: %d 00yL0L}N0 %02d%c%02d%c%02d%c%02d L0L}N0 10 P~0g0n0000000000OF0S0h0L0g0M0~0Y00 TIMER [ON|OFF] [/S] [/n] [/Fn] ON 000000000 ON k0W0~0Y00 OFF 000000000 OFF k0W0~0Y00 /S Split time. 00000000n0$P0 YfY00S0h0j0O00 s(W;R0g0D00Bf0h:yW0~0Y00 /n 00000000juS0c[W0~0Y00 00000000o0 0 K00 9 ~0g0L0)R(ug0M0~0Y00 c[W0j0D04XT000000h0W0f0 1 0OD0~0Y00 /Fn QRn0f_ n k0o0!kn0Nd0n0$P0(uD00S0h0L0g0M0~0Y0: 0 00y 1 hh%cmm%css%cdd ON0OFF0/S n0D0Z000c[W0j0K0c0_04XTk0o0000000000n0 rKa0R0fH0~0Y00 N0000 0000~0_0o00000n0Q[0h:yW0~0Y00 TYPE [0000:][00]0000 T /P 1 ^k0 1 ;ubZ0d0h:yW0~0Y00 uS0n00000o0000g0Y0!! 0000L00000k0ckW0O0fM0~00_0S0h00gqTY00K0i0F0K00c:yW0~0Y00 VERIFY [ON | OFF] s(Wn0-[0h:yY00h0M0o00000000c[[0Z0k0 VERIFY h0eQRW0f0O0`0U0D00 VERIFY o0 %s g0Y00 ON K0 OFF n0i0a00K00c[W0f0O0`0U0D00e000n000000`1X0h:yW0~0Y00 VER [/C][/R][/W] /C 000000h:yW0~0Y00 /R QM^k0Y00`1X0h:yW0~0Y00 /W O x0c0f0O0`0U0D00 gen000000o0!kn0000K00eQKbg0M0~0Y0: http://www.reactos.org FreeDOS version written by:  ReactOS version written by: Wy[wietla lub ustawia czas systemowy. TIME [/T][czas] /T tylko wy[wietla Wpisz TIME bez |adnych parametrw, by wy[wietli obecny czas i zapyta o nowy. Naci[nicie ENTER bez podawania czasu zachowuje obecny. Wprowadz nowy czas: UpBynBo %d milisek. UpBynBo %02d%c%02d%c%02d%c%02d ^Umo|liwia u|ycie stoperw (maksymalnie 10 na raz). TIMER [ON|OFF] [/S] [/n] [/Fn] ON uruchamia stoper OFF wyBcza stoper /S Dzieli czas. Zwraca poBow czasu na stoperze, bez zmieniania go. /n Definiuje numer stopera. Dostpne s numery od 0 do 9 Domy[lnie stoper dostaje numer 1 /Fn Format wy[wietlania czasu, n mo|liwo[ci: 0 millisekundy 1 hh%cmm%css%cdd je[li nie podano w skBadni parametrw: ON, OFF or /S, komenda zmieni obecny stan stopera vWy[wietla zawarto[ plikw tekstowych. TYPE [napd:][[cie|ka]nazwa_pliku /P Pauzuje po ka|dym peBnym ekranie. Ta komenda jest tylko na podpuchOdpowiada za to, czy po zapisaniu plikw ma nastpi sprawdzenie poprawno[ci tego zapisu. VERIFY [ON | OFF] Wpisz VERIFY bez |adnych parametrw by sprawdzi aktualne ustawienie komendy. Stan VERIFY: %s. Musisz okre[li: ON czy OFF.Wy[wietla informacje o wersji powBoki VER [/C][/R][/W] /C Wy[wietla podzikowania. /R Wy[wietla informacje o redystrybucji. /W Wy[wietla informacje o gwarancji. jest rozpowszechniany BEZ {ADNEJ GWARANCJI; szczegBy dostpne - wpisz: `ver /w'. To jest darmowe oprogramowanie, i mo|na je rozpowszechnia pod pewnymi warunkami: wpisz `ver /r'. Lista podzikowaD pod parametrem: `ver /c'. Program ten jest rozpowszechniany w dobrej wierze, ze wzgldu na jego u|yteczno[, ale BEZ {ADNEJ GWARANCJI; nie jest on przeznaczony NA SPRZEDA{, ani do u|ytku profesjonalnego. SzczegBy dostpne w GNU General Public License. To jest darmowe oprogramowanie; mo|esz je rozpowszechnia i modyfikowa, o ile nie naruszasz warunkw GNU General Public License, w formie opublikowanej przez Free Software Foundation; wersja 2 albo dowolna pzniejsza. Raporty o bBdach prosimy przesyBa pod adres: <ros-dev@reactos.org>. Uaktualnienia dostpne na stronie: http://www.reactos.org! wersja FreeDOS, napisana przez: ! wersja ReactOS, napisana przez: K2>4 8;8 87<5=5=85 2@5<5=8. TIME [/T][2@5<O] /T =5 87<5=OBL 2@5<O TIME 157 ?0@0<5B@>2 2K2>48B B5:CI55 2@5<O 8 70?@0H8205B =>2>5 2@5<O. 060B85 ENTER A>E@0=8B B5:CI55 2@5<O. 2548B5 =>2>5 2@5<O: @>H;> %d <A5: @>H;> %02d%c%02d%c%02d%c%02d 2!5:C=4><5@. TIMER [ON|OFF] [/S] [/n] [/Fn] ON :;NG8BL A5:C=4><5@ OFF K:;NG8BL A5:C=4><5@ /S 07=8F0 2@5<5=8. >72@0I05B @07=8FC 2@5<5=8 A5:C=4><5@0 157 87<5=5=8O 53> 7=0G5=8O /n 040BL =><5@ A5:C=4><5@0. >ABC?=K5 =><5@0 - >B 0 4> 9 =0G5=85 ?> C<>;G0=8N - 1 /Fn $>@<0B 2K2>40 n >4=> 87: 0 <8;;8A5:C=4K 1 GG%c<<%cAA%c44 A;8 =8 >48= 87 ?0@0<5B@>2 =5 C:070=, :><0=40 ?5@5:;NG05B A>AB>O=85 A5:C=4><5@0 sK2>4 A>45@68<>3> >4=>3> 8;8 =5A:>;L:8E B5:AB>2KE D09;>2. TYPE [48A::][?CBL]8<O D09;0 /P >M:@0==K9 2K2>4. This command is just a dummy!! :;NG5=85 8;8 >B:;NG5=85 @568<0 ?@>25@:8 ?@028;L=>AB8 70?8A8 D09;>2 a =0 48A:. VERIFY [ON | OFF] VERIFY 157 ?0@0<5B@0 2K2>48B B5:CI55 7=0G5=85 MB>9 :><0=4K. VERIFY %s. 5>1E>48<> C:070BL ON 8;8 OFF.K2>4 25@A88 VER [/C][/R][/W] /C Displays credits. /R Displays redistribution information. /W Displays warranty information. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. m >AK;09B5 >BG5BK >1 >H81:0E =0 <ros-dev@reactos.org>. 1=>2;5=8O 4>ABC?=K ?> 04@5AC: http://www.reactos.org/ FreeDOS-25@A8O =0?8A0=0:  ReactOS-25@A8O =0?8A0=0: Displays or sets the system time. TIME [/T][time] /T display only Type TIME with no parameters to display the current time setting and a prompt for a new one. Press ENTER to keep the same time. Zadajte nov as: Elapsed %d msecs Elapsed %02d%c%02d%c%02d%c%02d Fallow the use of ten stopwatches. TIMER [ON|OFF] [/S] [/n] [/Fn] ON set stopwatch ON OFF set stopwatch OFF /S Split time. Return stopwatch split time without changing its value /n Specifiy the stopwatch number. Stopwatches available are 0 to 9 If it is not specified default is 1 /Fn Format for output n can be: 0 milliseconds 1 hh%cmm%css%cdd if none of ON, OFF or /S is specified the command will toggle stopwatch state rDisplays the contents of text files. TYPE [drive:][path]filename /P Shows one screen of output at a time. This command is just a dummy!! Sets whether to verify that your files are written correctly to a disk. VERIFY [ON | OFF] Type VERIFY without a parameter to display the current VERIFY setting. VERIFY je %s. Must specify ON or OFF.Displays shell version information VER [/C][/R][/W] /C Displays credits. /R Displays redistribution information. /W Displays warranty information. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. l Hlsenia o chybch zasielajte na <ros-dev@reactos.org>. Aktualizcie s dostupn na: http://www.reactos.org FreeDOS version written by:  ReactOS version written by: Menampilkan atau menyetel jam sistem. TIME [/T][time] /T hanya menampilkan Ketik TIME tanpa parameter untuk menampilkan setelan jam saat ini dan meminta yang baru. Tekan ENTER untuk membiarkan jam tetap sama. Masukkan jam baru: Berlalu %d mdetik Berlalu %02d%c%02d%c%02d%c%02d mengijinkan penggunaan sepuluh stopwatch. TIMER [ON|OFF] [/S] [/n] [/Fn] ON menyetel stopwatch ON OFF menyetel stopwatch OFF /S Memisahkan jam. Mengembalikan pemisahan jam stopwatch tanpa mengubah nilainya /n Menetapkan nomor stopwatch. Stopwatch yang tersedia adalah 0 sampai 9 Jika tidak ditetapkan standarnya adalah 1 /Fn Format output n bisa berupa: 0 milidetik 1 hh%cmm%css%cdd jika tidak ada yang ON, OFF atau /S ditetapkan dalam perintah akan menghidupkan/mematikan keadaan stopwatch sMenampilkan isi dari file teks. TYPE [drive:][path]filename /P Menampilkan satu layar output sekali waktu. Perintah ini hanya dummy!! Menyetel apakah memverifikasi bawa file anda ditulis dengan benar ke disk. VERIFY [ON | OFF] Ketik VERIFY tanpa parameter untuk menampilkan setelan VERIFY sekarang. VERIFY adalah %s. Harus menetapkan ON atau OFF.Menampilkan Displays shell version information VER [/C][/R][/W] /C Menampilkan penghargaan. /R Menampilkan informasi redistribusi. /W menampilkan informasi jaminan. datang dengan MUTLAK TANPA JAMINAN; untuk lengkapnya ketik: 'ver /w'. Program ini adalah software bebas; anda bisa membagikannya di bawah kondisi tertentu; ketik 'ver /r' untuk lengkapnya. Ketik 'ver /c' untuk daftar penghargaan. Program ini didistribusikan dengan harapan berguna, tetapi TANPA JAMINAN APAPUN; bahkan tanpa jaminan berarti dari MERCANTABILITAS atau KECUKUPAN UNTUK KEPERLUAN TERTENTU. Lihat GNU General Public License untuk lebih jelasnya. Program ini adalah software bebas; anda dapat mendistribusikan dan/atau mengubahnya di bawah term GNU General Public License seperti dipublikasikan oleh Free Software Foundation; baik Lisensi versi 2, atau (menurut opini anda) setiap versi berikutnya. \ Kirim laporan bug ke <ros-dev@reactos.org>. Pemutakiran tersedia di: http://www.reactos.org Versi FreeDOS ditulis oleh:  Versi ReactOS ditulis oleh: Displays or sets the system time. TIME [/T][time] /T display only Type TIME with no parameters to display the current time setting and a prompt for a new one. Press ENTER to keep the same time. Enter new time: Elapsed %d msecs Elapsed %02d%c%02d%c%02d%c%02d Fallow the use of ten stopwatches. TIMER [ON|OFF] [/S] [/n] [/Fn] ON set stopwatch ON OFF set stopwatch OFF /S Split time. Return stopwatch split time without changing its value /n Specifiy the stopwatch number. Stopwatches available are 0 to 9 If it is not specified default is 1 /Fn Format for output n can be: 0 milliseconds 1 hh%cmm%css%cdd if none of ON, OFF or /S is specified the command will toggle stopwatch state rDisplays the contents of text files. TYPE [drive:][path]filename /P Shows one screen of output at a time. This command is just a dummy!! Sets whether to verify that your files are written correctly to a disk. VERIFY [ON | OFF] Type VERIFY without a parameter to display the current VERIFY setting. VERIFY is %s. Must specify ON or OFF.Displays shell version information VER [/C][/R][/W] /C Displays credits. /R Displays redistribution information. /W Displays warranty information. comes with ABSOLUTELY NO WARRANTY; for details type: `ver /w'. This is free software, and you are welcome to redistribute it under certain conditions; type `ver /r' for details. Type `ver /c' for a listing of credits. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. \ Send bug reports to <ros-dev@reactos.org>. Updates are available at: http://www.reactos.org FreeDOS version written by:  ReactOS version written by: luft in %s# Datentrger im Laufwerk %c ist %s 3 Datentrger im Laufwerk %c hat keine Bezeichnung. % Datentrger-Seriennummer: %04X-%04X ]Zeigt die Laufwerksbezeichnung und die Seriennummer an, falls diese existieren. VOL [drive:]$Verndert die Gre des Konsolenfensters WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS Gibt Position und Gre des Fensters an MIN minimiert das Fenster MAX maximiert das Fenster RESTORE stellt das Fenster wieder herVerndert die Gre des Konsolenfensters ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window Titel des Fensters, das bearbeitet wird /POS einstellen der Fensterplatzierung und der Dimensionen MIN minimiert das Fenster MAX maximiert das Fenster RESTORE stellt das Fenster wieder her title neuer Titel %d Datei(en) kopiert gewipedungltige Variablenangabe.ungltige Spalten-Angabeungltige Zeilen-AngabeTimer %d ist %s: bersicht aller verfgbaren Befehle und deren Kurzbeschreibungen Befehl /? Um nhere Informationen zu einem bestimmten Befehl zu erhalten. ? Listet alle Befehle auf (ohne Erklrung). ALIAS Setzt, lscht oder zeigt den Alias. ATTRIB Zeigt Dateiattribute an bzw. ndert sie. BEEP Gibt einen piep-Ton durch den PC-Speaker aus. CALL Ruft eine Batchdatei aus einer anderen Batchdatei heraus auf. CD Zeigt den Namen des aktuellen Verzeichnisses an bzw. ndert diesen. CHCP Zeigt die aktive Codepagenummer an bzw. legt diese fest. CHOICE Wartet auf den Benutzer, welcher aus einer Auswahl eine Option whlen muss. CLS Lscht den Bildschirminhalt. CMD Startet eine neue Instanz des ReactOS-Befehlsinterpreters. COLOR Legt die Farben fr Hinter- und Vordergrund der Konsole fest. COPY Kopiert eine oder mehrere Dateien an eine andere Stelle. DATE Zeigt das Datum an bzw. legt dieses fest. DELETE Lscht eine oder mehrere Dateien. DIR Listet die Dateien und Unterverzeichnisse eines Verzeichnisses auf. ECHO Zeigt Meldungen an bzw. schaltet die Befehlsanzeige ein oder aus. ERASE Lscht eine oder mehrere Dateien. EXIT Beendet das Programm CMD.EXE (Befehlsinterpreter). FOR Fhrt einen angegebenen Befehl fr jede Datei in einem Dateiensatz aus. FREE Zeigt den (freien) Speicherplatz an. GOTO Setzt den ReactOS-Befehlsinterpreter auf eine markierte Zeile in einem Batchprogramm. HELP Zeigt Hilfeinformationen zu ReactOS-Befehlen an. HISTORY Listet alle Befehle auf, welche sich im Speicher befinden. IF Verarbeitet Ausdrcke in einer Batchdatei abhngig von Bedingungen. LABEL Erstellt, ndert oder lscht die Bezeichnung eines Volumes. MD Erstellt ein Verzeichnis. MKDIR Erstellt ein Verzeichnis. MKLINK Creates a filesystem link object. MOVE Verschiebt eine oder mehrere Dateien von einem Verzeichnis in ein anderes. PATH Legt den Suchpfad fr ausfhrbare Dateien fest oder zeigt diesen an. PAUSE Hlt die Ausfhrung einer Batchdatei an und zeigt eine Meldung an. POPD Wechselt zu dem Verzeichnis, das durch PUSHD gespeichert wurde. PROMPT ndert die Eingabeaufforderung. PUSHD Speichert das aktuelle Verzeichnis, und wechselt dann zu einem anderen Verzeichnis. RD Entfernt ein Verzeichnis. REM Leitet Kommentare in einer Batchdatei. REN Benennt eine od. mehrere Dateien um. RENAME Benennt eine od. mehrere Dateien um. REPLACE Ersetzt Dateien. RMDIR Lscht ein Verzeichnis. SCREEN Bewegt den Cursor und optional die Ausgabe. SET Setzt oder lscht die Umgebungsvariablen bzw. zeigt sie an. SHIFT Verndert die Position ersetzbarer Parameter in Batchdateien. /START Startet ein eigenes Fenster, um ein bestimmtes Programm oder einen Befehl auszufhren. TIME Zeigt die Systemzeit an bzw. legt sie fest. TIMER Erlaubt die Benutzung von bis zu 10 Stoppuhren TITLE Legt den Fenstertitel fr das Eingabeaufforderungsfenster fest. TYPE Zeigt den Inhalt einer Textdatei an. VER Zeigt die ReactOS-Version an. VERIFY Legt fest, ob berwacht werden soll, ob Dateien korrekt auf den Datentrger geschrieben werden. VOL Zeigt die Datentrgervolumebezeichnung und die Seriennummer an.  corriendo en %s" El volumen en la unidad %c es %s / El volumen en la unidad %c no tiene etiqueta. - El nmero de serie del volumen es %04X-%04X YMuestra la etiqueta del volumen del disco y el nmero de serie si existen. VOL [unidad:]%Cambia el aspecto de la ventana de la consola. WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS Especifica la posicin y dimensin de la ventana MIN minimiza la ventana MAX maximiza la ventana RESTORE restaura la ventanaCambia el aspecto de la ventana de la consola. ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window Ttulo de la ventana en la que realizar las accines /POS Especifica la posicin y dimensin de la ventana MIN minimiza la ventana MAX maximiza la ventana RESTORE restaura la ventana title Nuevo ttulo %d archivo(s) copado(s) LimpiadoEspecicin de variable errnea.Valor invlido de columnaValor invlido de filaEl temporizador %d es %s: Lista de todos los comandos disponibles (con descripcin) comando /? Para ms informacin del comando especificado. ? Muestra todos los comandos disponibles (sin la descripcin). ALIAS Crea, borra o muestra los alias. ATTRIB Muestra o cambia los atributos de archivo. BEEP Hace un beep con el altavoz. CALL Llama a un archivo por lotes desde otro. CD Muestra o cambia el directorio actual. CHCP Muestra o cambia el cdigo de pgina activo. CHOICE Espera a que el usuario elija una opcin de un grupo de opciones. CLS Limpia la pantalla. CMD Comienza una nueva instancia del intrprete de comandos. COLOR Configura el color por defecto de fondo y frente de la consola. COPY Copia uno o varios archivos de una localizacin a otra. DATE Muestra y cambia la fecha. DELETE Borra uno o ms archivos. DIR Muestra una lista de los archivos y subdirecctorios en un directorio. ECHO Muestra mensajes, o cambia un comando entre mostrarlos o no. ERASE Borra uno o ms archivos. EXIT Sale del programa CMD.EXE (intrprete de comandos). FOR Ejecuta un comando especfico en un grupo de archivos. FREE Espacio libre en disco. GOTO Direcciona la ventana del intrprete de comandos a una linea etiquetada en un archivo por lotes. HELP Proporciona ayuda sobre los comandos para ReactOS. HISTORY Muestra todos los comandos que han sido usados. IF Realiza un proceso condicional en un archivo por lotes. LABEL Crea, cambia, o borra la etiqueta de volumen de un disco. MD Crea un directorio. MKDIR Crea un directorio. MKLINK Creates a filesystem link object. MOVE Mueve uno o ms archivos de un directorio a otro. PATH Muestra o configura las rutas de bsqueda para archivos ejecutables. PAUSE Suspende el procesamiento de un archivo por lotes y muestra un mensaje. POPD Restaura el valor anterior del directorio actual guardado por PUSHD. PROMPT Cambia el smbolo del sistema del intprete de comandos. PUSHD Guarda el directorio actual y despus lo cambia. RD Borra un directorio. REM Marca comentarios en archivos por lotes. REN Renombra un archivo o varios archivos. RENAME Renombra un archivo o varios archivos. RMDIR Borra un directorio. SCREEN Mueve el cursor y opcionalmente escribe un texto. SET Muestra, cambia o borra variables del entorno de la ventana. SHIFT Marca la posicin de parmetros remplazables en un archivo por lotes. START Abre una ventana separada para ejecutar un programa o comando especficod. Ejecuta CMD. TIME Muestra o cambia la hora del sistema. TIMER Permite al usuario diez paradas para ver. TITLE Configura el ttulo de la ventama de la sesin de CMD.EXE. TYPE Muestra el contenido de un archivo de texto. VER Muestra la versin de ReactOS. VERIFY Le dice a ReactOS que verifique que cada archivo se escriba. corectamente en el disco. VOL Muestra la etiqueta de volumen y el nmero de serie del disco.  tournant sur %s' Le nom de volume du lecteur %c est %s - Le volume dans le lecteur %c n'a pas de nom , Le numro de srie du volume est %04X-%04X YAffiche le nom de volume et le numro de srie du disque s'ils existent. VOL [lecteur:] +Change l'aspect de la fentre de la console WINDOW [/POS[=]gauche,haut,largeur,hauteur] [MIN|MAX|RESTORE] ['titre'] /POS indique la position et les dimensions de la fentre MIN minimise la fentre MAX maximise la fentre RESTORE restaure la fentreChange l'aspect de la fentre de la console ACTIVATE 'fentre' [/POS[=]gauche,haut,largeur,hauteur] [MIN|MAX|RESTORE] ['titre'] fentre titre de la fentre sur laquelle effectuer les actions /POS indique la position et les dimensions de la fentre MIN minimise la fentre MAX maximise la fentre RESTORE restaure la fentre titre titre de la fentre %d fichier(s) copi(s) effac(s)mauvaise variable spcifie.valeur invalide pour colvaleur invalide pour ligLe timer n%d est %s : Liste de toutes les commandes disponibles (+ description) commande /? Pour plus d'informations sur une commande spcifique ? Liste toutes les commandes disponibles sans leur description). ALIAS Dfini, supprime ou montre les alias. ATTRIB Affiche ou change les attributs d'un fichier. BEEP met un bip par le haut-parleur systme. CALL Appelle un programme batch partir d'un autre. CD Affiche ou change le rpertoire courant. CHCP Affiche ou dfini le numro de page de codes. CHOICE Attend aprs l'utilisateur pour un choix parmi un ensemble de propositions. CLS Efface l'cran. CMD Dmarre une nouvelle instance de l'interprteur de commandes de ReactOS. COLOR Dfini les couleurs par dfaut pour le premier plan et l'arrire-plan de la console. COPY Copie un ou plusieurs fichiers vers une autre destination. DATE Affiche ou dfini la date. DELETE Supprime un ou plusieurs fichiers. DIR Affiche la liste des fichiers et des sous-rpertoires du dossier. ECHO Affiche des messages, ou bascule l'affichage des commandes sur on ou off. ERASE Supprime un ou plusieurs fichiers. EXIT Quitte le programme CMD.EXE (interprteur de commandes). FOR Lance une commande spcifique pour chaque fichier d'un ensemble de fichiers. FREE Espace disque (libre). GOTO Dirige l'interprteur de commandes de ReactOS vers une ligne nomme dans un script batch. HELP Fournit des informations d'aide pour les commandes de ReactOS. HISTORY Liste toutes les commandes qui ont t utilises IF Excute un traitement conditionnel dans des programmes batch. LABEL Cr, change, ou supprime le nom de volume d'un disque. MD Cr un rpertoire. MKDIR Cr un rpertoire. MKLINK Creates a filesystem link object. MOVE Dplace un ou plusieurs fichiers d'un rpertoire vers un autre rpertoire. PATH Affiche ou dfini un chemin de recherche pour les fichiers excutables. PAUSE Suspend l'excution d'un fichier batch et affiche un message. POPD Restaure la prcdente valeur du rpertoire courant sauvegarde par PUSHD. PROMPT Change l'invite de commande. PUSHD Sauvegarde le rpertoire courant puis le change. RD Supprime un rpertoire. REM Enregistre des commentaires (remarques) dans un fichier batch. REN Renomme un ou plusieurs fichiers. RENAME Renomme un ou plusieurs fichiers. REPLACE Remplace un fichier. RMDIR Supprime un rpertoire. SCREEN Dplace le curseur, optionnellement affiche du texte. SET Affiche, dfini, ou supprime des variables d'environnement de ReactOS. SHIFT Dplace la position des paramtres remplacables dans un fichier batch. *START Dmarre une fentre spare pour lancer un programme spcifi ou une commande. Excute la commande. TIME Affiche ou dfini l'heure du systme. TIMER Permet l'utilisation de dix chronomtres. TITLE Dfini le titre de la fentre pour une session de CMD.EXE. TYPE Affiche le contenu d'un fichier texte. VER Affiche la version de ReactOS. VERIFY Spcifie ReactOS s'il faut vrifier que les fichiers sont correctement crit sur un disque. VOL Affiche le nom de volume d'un disque et son numro de srie.  in esecuzione su %s Il Volume del disco %c %s ) Il Volume del disco %c non ha etichetta + Il numero di serie del Volume %04X-%04X ^Visualizza l'etichetta del volume del disco e il numero di serie se disponibili. VOL [disco:]<Cambia l'aspetto della finestra della console WINDOW [/POS[=]sinistra,alto,larghezza,altezza] [MIN|MAX|RESTORE] ['titolo'] /POS specifica la posizione e la dimensione della finestra MIN minimizza la finestra MAX massimizza la finestra RESTORE ripristina la finestraCambia l'aspetto della finestra della console ACTIVATE 'window' [/POS[=]sinistra,alto,larghezza,altezza] [MIN|MAX|RESTORE] ['title'] window finestra su cui eseguire l'azione /POS indica la posizione e la dimensione della finestra MIN minimizza la finestra MAX massimizza la finestra RESTORE ripristina la finestra titolo il nuovo titolo  %d file copiati resi illeggibilivariabile non valida.valore non valido per colonnavalore non valido per rigaTimer %d %s: Elenco di tutti i comandi disponibili (+ descrizione) comando /? Per i dettagli su uno specifico comando ? Elenco di tutti i comandi disponibili. ALIAS Imposta, toglie o visualizza gli alias. ASSOC Modifica le associazioni per le estensioni dei file. ATTRIB Visualizza o modifica gli attributi dei file. BEEP Segnale acustico. CALL Chiama un batch da un'altro. CD Visualizza il nome o modifica la cartella corrente. CHCP Visualizza o imposta il numero della tabella dei codici. CHOICE Aspetta che l'utente scelga una tra le opzioni disponibili. CLS Cancella lo schermo. CMD Esegue un altro interprete dei comandi. COLOR Imposta i colori della console. COPY Copia uno o pi file in un'altra destinazione. DATE Visualizza o modifica la data. DELETE Cancella uno o pi file. DIR Visualizza un elenco di file e sottocartelle in una cartella. ECHO Visualizza messaggi o abilita e disabilita la visualizzazione dei comandi. ERASE Cancella uno o pi file. EXIT Esce dall'interprete dei comandi. FOR Esegue un comando per ognuno dei file indicati. FREE Spazio libero. GOTO Salta a una etichetta durante l'esecuzione di un batch. HELP Fornisce informazioni sui comandi di ReactOS. HISTORY Elenco degli ultimi comandi usati IF Esegue elaborazioni condizionali in un batch. LABEL Crea, modifica, o cancella l'etichetta di un disco. MD Crea una cartella. MKDIR Crea una cartella. MKLINK Crea un oggetto di collegamento nel filesystem. MOVE Muove uno o pi file da una cartella a un'altra PATH Visualizza o imposta i percorsi di ricerca per gli eseguibili. PAUSE Ferma l'esecuzione di un batch e visualizza un messaggio. POPD Ripristina il valore precedente della cartella corrente salvato da PUSHD. PROMPT Cambia il messaggio di pronto per i comandi. PUSHD Salva la cartella corrente e poi la cambia. RD Rimuove una cartella. REM Commenti in un batch. REN Rinomina uno pi file. RENAME Rinomina uno pi file. RMDIR Rimuove una cartella. SCREEN Sposta il cursore e visualizza un testo. SET Visualizza, modifica, o cancella le variabili di ambiente. SHIFT Scorre la posizione dei parametri nei batch. START Apre una finestra separata ed esegue uno specifico comando. TIME Visualizza o modifica l'ora di sistema. TIMER Permette l'uso di cronometri. TITLE Imposta il titolo della finestra per una sessione di CMD.EXE. TYPE Visualizza il contenuto di un file di testo. VER Visualizza la versione di ReactOS. VERIFY Richiede che ReactOS verifichi che i file siano scritti correttamente su disco. VOL Visualizza l'etichetta del volume e il numero di serie del disco. kjrer p %s Volumet i stasjon %c er %s & Volumet i stasjon %c har ingen navn. # Volumet Serie nummer er %04X-%04X LVis disk volumet merke og serie nummer, hvis det eksisterer. VOL [stasjon:] endre konsoll vindu aspekt WINDOW [/POS[=]venstre,topp,bredde,hyde] [MINI|MAKS|GJENOPPRETT] ['tittel'] /POS spesifisere vindusposisjon og strrelse MINI minimer vinduet MAKS maksimer vinduet GJENOPPRETT gjenopprett vinduetgendre konsoll vindu aspekt ACTIVATE 'window' [/POS[=]venstre,topp,bredde,hyde] [MINI|MAKS|GJENOPPRETT] ['tittel'] vindu tittel av vindu p stad fullfre handlinger /POS spesifisere vindu plass og strrelse MIN minimer vinduet MAX maksimer vinduet RESTORE gjenopprett vinduet tittel ny tittel  %d file(r) kopiert slettetugyldig variabel spesifikasjon.ugyldig verdi for kolonneugyldig verdi for radStoppeklokke %d er %s: Liste av alle tilgjengelige kommandoer (+ beskrivelse) kommando /? For mer informasjon om en bestemt kommando ? Lister alle tilgjengelige kommando uten beskrivelse). ALIAS Sett, fjern eller vis alias. ATTRIB Viser eller endre fil attributter. BEEP Piper i hyttaleren. CALL Starte et satsvis program fra et annet. CD Vis navnet p eller endrer gjeldende mappe. CHCP Viser eller angir nummer p aktiv tegntabell. CHOICE Venter til bruken velger en av et sett av valg. CLS Tmmer skjermen. CMD Start en ny forekomst av ReactOS kommandotolk. COLOR Angir standard forgrunn- og bakgrunnsfargr for konsollen. COPY Kopierer en eller flere filer til en annen plassering. DATE Viser eller angir datoen. DELETE Sletter en eller flere filer. DIR Viser en liste over filer og undermapper i en mappe. ECHO Viser meldinger, eller slr kommandoecho p eller av. ERASE Sletter en eller flere filer. EXIT Avslutter programmet CMD.EXE program (kommandotolken). FOR Kjr en bestemt kommando for hver fil i et sett av filer. FREE Viser ledig diskplass. GOTO Leder ReactOS kommandotolk til en merket linje i et satsvis program. HELP Viser hjelpeinformasjon for ReactOS-kommandoer. HISTORY Lister alle kommandoer som har blitt brukt IF Utfre betinget behandling i satsvise programmer. LABEL Oppretter, endrer, eller sletter volumnavnet p en disk. MD Oppretter en mappe. MKDIR Oppretter en mappe. MKLINK Creates a filesystem link object. MOVE Flytter en eller flere filer fra en mappe til en annen. PATH Vis eller sett en skesti for kjrbare filer. PAUSE Avbryter behandling av en satsvis fil, og viser en melding. POPD Fjenoppretter den forige verdien av gjeldende mappe, lagret av PUSHD. PROMPT Endre kommandoledeteksten. PUSHD Lagre gjeldende mappe og endrer den etterp. RD Fjerner en mappe. REM Angir kommentarer i satsvise filer. REN Gir nytt navn til en eller flere filer. RENAME Gir nytt navn til en eller flere filer. RMDIR Fjerner en mappe. SCREEN Flytter markr. SET Vis, sett, eller fjern ReactOS miljvariabel. SHIFT Shift plass for erstattelige parameter i satsvise filer. START Start et separat vindu til kjre et spesifisert program eller kommando. Utfrer kommando. TIME Vis eller sett system tid. TIMER Hndtere stoppeklokker (maks 10 stk). TITLE Sett vindustittel for CMD.EXE sesjon. TYPE Vis innholdet i en tekst fil. VER Viser ReactOS versjon. VERIFY Forteller ReactOS om bekrefte om dine filer er skrevet riktig til disk. VOL Vis et volums navn og serienummer.  running on %s Volume in drive %c is %s " Volume in drive %c has no label. # Volume Serial Number is %04X-%04X NDisplays the disk volume label and serial number, if they exist. VOL [drive:] change console window aspect WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the windowcchange console window aspect ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile of window on which perform actions /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the window title new title  %d file(s) copied wipedbad variable specification.invalid value for colinvalid value for rowTimer %d is %s: Y List of all available commands (+ description) command /? For more information on a specific command ? List all available commands without description). ALIAS Sets, removes or shows aliases. ATTRIB      . BEEP Beep the speaker. CALL       . CD         . CHCP        . CHOICE Waits for the user to choose one of a set of choices. CLS   . CMD          ReactOS. COLOR          . COPY        . DATE     . DELETE     . DIR        . ECHO        echo . ERASE     . EXIT    CMD.EXE ( ). FOR          . FREE (free) disc space. GOTO      ReactOS         . HELP       ReactOS. HISTORY        . IF       . LABEL ,        . MD   . MKDIR   . MKLINK Creates a filesystem link object. MOVE           . PATH         . PAUSE          . POPD       ,     PUSHD. PROMPT    . PUSHD         . RD   . REM   ()      CONFIG.SYS. REN     . RENAME     . REPLACE  . RMDIR   . SCREEN Move cursor and optionally print text. SET ,       Windows. SHIFT           . /START            . TIME       . TIMER Allow the use of ten stopwatches. TITLE        CMD.EXE. TYPE      . VER     ReactOS. VERIFY   Windows                . VOL           .  running on %s Volume in drive %c is %s " Volume in drive %c has no label. # Volume Serial Number is %04X-%04X NDisplays the disk volume label and serial number, if they exist. VOL [drive:] change console window aspect WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the windowcchange console window aspect ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile of window on which perform actions /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the window title new title  %d file(s) copied wipedbad variable specification.invalid value for colinvalid value for rowTimer %d is %s: 6 List of all available commands (+ description) command /? For more information on a specific command ? List all available commands (without description). ALIAS Sets, removes or shows aliases. ATTRIB Displays or changes file attributes. BEEP Beep the speaker. CALL Calls one batch program from another. CD Displays the name of or changes the current directory. CHCP Displays or sets the active code page number. CHOICE Waits for the user to choose one of a set of choices. CLS Clears the screen. CMD Starts a new instance of the ReactOS command interpreter. COLOR Sets the default console foreground and background colors. COPY Copies one or more files to another location. DATE Displays or sets the date. DELETE Deletes one or more files. DIR Displays a list of files and subdirectories in a directory. DLL Loads a DLL. ECHO Displays messages, or turns command echoing on or off. ERASE Deletes one or more files. EXIT Quits the CMD.EXE program (command interpreter). FOR Runs a specified command for each file in a set of files. FREE (free) disc space. GOTO Directs the ReactOS command interpreter to a labeled line in a batch program. HELP Provides Help information for ReactOS commands. HISTORY List all commands which has been used IF Performs conditional processing in batch programs. LABEL Creates, changes, or deletes the volume label of a disk. MD Creates a directory. MKDIR Creates a directory. MKLINK Creates a filesystem link object. MOVE Moves one or more files from one directory to another directory. PATH Displays or sets a search path for executable files. PAUSE Suspends processing of a batch file and displays a message. POPD Restores the previous value of the current directory saved by PUSHD. PROMPT Changes the command prompt. PUSHD Saves the current directory then changes it. RD Removes a directory. REM Records comments (remarks) in batch files. REN Renames a file or files. RENAME Renames a file or files. REPLACE Replaces files. RMDIR Removes a directory. SCREEN Move cursor and optionally print text. SET Displays, sets, or removes ReactOS environment variables. SHIFT Shifts the position of replaceable parameters in batch files. START Starts a separate window to run a specified program or command. Executes command. TIME Displays or sets the system time. TIMER Allow the use of ten stopwatches. TITLE Sets the window title for a CMD.EXE session. TYPE Displays the contents of a text file. VER Displays the ReactOS version. VERIFY Tells ReactOS whether to verify that your files are written correctly to a disk. VOL Displays a disk volume label and serial number.  running on %s# A (%c) meghajtban lvQ ktet: %s 0 A (%c) meghajtban lvQ ktetnek nincs cmkje A ktet sorozatszma %04X-%04X RA ktet cmkjnek s sorozatszmnak megjelentse, ha lteznek. VOL [meghajt:] change console window aspect WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the windowbchange console window aspect ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile of window on wich perform actions /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the window title new title  %d llomny msolva wipedHibs vltoz.rvnytelen rtk oszlopnakrvnytelen rtk sornakIdQztQ %d rtke %s: ' Tmogatott parancsok megjelentse parancs /? Tbb (rszletes) informci megtekintshez hasznld ezt. ? Minden tmogatott parancs megjelentse (rszletek nlkl). ALIAS Megjelenti, vagy megvltoztatja az aliasokat. ATTRIB Megjelenti vagy megvltoztatja az llomnyok attribtumt. BEEP Megszlaltatja a hangszrt. CALL Batch llomnybl egy msik batch llomny meghvsa. CD Megjelenti vagy tvlt egy msik mappba. CHCP Megjelenti vagy megvltoztatja az aktv kdlapot. CHOICE Vr a felhasznlra, hogy vlasszon a felknlt lehetQsgek kzl. CLS Letrli a kpernyQt. CMD Egy j pldnyt indt a ReactOS parancsrtelmezQjbQl. COLOR A konzol elQ- s httrsznt lltja be. COPY Egy vagy tbb llomnyt msol a megadott helyre. DATE Megjelenti vagy belltja a rendszerdtumot. DELETE Eltvolt egy vagy tbb llomnyt. DIR Megjelenti a mappban tallhat almappkat s llomnyokat. ECHO Megjelent egy szveget, vagy belltja a visszhangot. ERASE Eltvolt egy vagy tbb fjlt. EXIT Kilp a parancssor rtelmezQbQl. FOR Vgrehajt egy parancsot az sszes fjlban a megadott mappkban. FREE Megjelenti a szabad hely mrett. GOTO tirnyt egy msik cmkre a batch llomnyban. HELP Segtsget ad a ReactOS parancsairl. HISTORY Megjelenti az ebben az ablakban kiadott parancsok listjt. IF Feltteles vgrehajts batch llomnyokban. LABEL Belltja egy ktet cmkjt. MD Ltrehoz egy j mappt. MKDIR Ltrehoz egy j mappt. MKLINK Creates a filesystem link object. MOVE thelyez egy vagy tbb llomnyt az egyik mappbl a msikba. PATH Megjelenti vagy belltja a keressi tvonalakat. PAUSE Felfggeszti a futst, s vr a felhasznlra. POPD Visszalp a PUSHD ltal megjegyzett mappba. PROMPT Parancssor belltsa. PUSHD Megjegyzi az aktulis mappt, majd tvlt egy masikra. RD Trl egy mappt. REM Megjegyzst jellQ sor batch fjlokban. REN tnevez egy llomnyt. RENAME tnevez egy llomnyt. RMDIR Trl egy mappt. SCREEN Megvltoztatja a kurzos pozcijt, vagy megjelent adott pozciban egy szveget. SET Megjelenti vagy belltja a krnyezeti vltozkat. SHIFT Eltolja a helyettesthetQ paramterek pozcijt a batch llomnyban. START Egy j ablakban hajtha vgre a parancsot. TIME Megjelenti vagy belltja a rendszeridQt. TIMER IdQztQk kezelst teszi lehetQve. TITLE Belltja az ablak cmsornak szvegt. TYPE Megjelenti egy llomny tartalmt. VER Megjelenti a ReactOS verzi informcijt. VERIFY rsi mqveletek ellenQrzst vezrli VOL Megjelenti egy ktet cmkjt s sorozatszmt.  running on %s 0000 %c: n000000 000o0 %s g0Y00  0000 %c: k0o000000 000L0B00~0[000  00000 0000juSo0 %04X-%04X g0Y00 1X[(WY00j00p000000n000000 000h00000juS0h:yW0~0Y00 VOL [0000:]00000 00000n0Y0 YfW0~0Y00 WINDOW [/POS[=]], N,E^,ؚU0] [MIN|MAX|RESTORE] ['title'] /POS 00000n0MOnh0'YM0U00c[W0~0Y00 MIN 000000g\SW0~0Y00 MAX 000000g'YSW0~0Y00 RESTORE 000000CQn0000k0;bW0~0Y0000000 00000n0Y0 YfW0~0Y00 ACTIVATE '00000' [/POS[=]], N,E^,ؚU0] [MIN|MAX|RESTORE] ['0000'] 00000 Y0 YfY0000000n00000g0Y00 /POS 00000n0MOnh0'YM0U00c[W0~0Y00 MIN 000000g\SW0~0Y00 MAX 000000g'YSW0~0Y00 RESTORE 000000CQn0000k0;bW0~0Y00 0000 eW0D00000g0Y00  %d Pn00000L0000U00~0W0_0 [hQk0mSU00~0W0_00!qRj0 YpeL0c[U00~0W0_00 Ln0$PL0!qRg0Y00 Rn0$PL0!qRg0Y000000 %d o0 %s g0Y00: )R(uSj0Y0y0f0n00000n0Nh00]0n0f0 0000 /? yr[n00000k0Y00s0}`1X ? )R(uSj0Y0y0f0n00000n0N (fj0W0)0 ALIAS 00000n0-[0d0W0_000000000h:yW0_00W0~0Y00 ATTRIB 0000^\'`0h:y~0_0o0 YfW0~0Y00 BEEP 0000K0000000W0~0Y00 CALL 000 000000%Rn0000 00000K00|Ts0QW0~0Y00 CD s(Wn00000000 YfW0_000000000 T0h:yW0_00W0~0Y00 CHCP s(Wn0000 000juS0h:y~0_0o0-[W0~0Y00 CHOICE 0000L0xbK00Nd00xbY00n00_a0~0Y00 CLS ;ub0mSW0~0Y00 CMD ReactOS 0000 0000000n0eW0D00000000YW0~0Y00 COLOR 00000n000000n0MRofrJ00s0̀ofr0-[W0~0Y00 COPY 1 d0~0_0o0pen000000%Rn04X@bk0000W0~0Y00 DATE eN0h:y~0_0o0-[W0~0Y00 DELAY n y0~0_0o0 n 00y__jW0~0Y00 DELETE 1 d0~0_0o0pen000000JRdW0~0Y00 DIR 000000-Nn00000h0000000000Nh:yW0~0Y00 ECHO 000000h:yW0_0000000 000n0 ON h0 OFF 0R0fH0~0Y00 ERASE 1 d0~0_0o0pen000000JRdW0~0Y00 EXIT CMD.exe (0000 000 0000000) 0B}NW0~0Y00 FOR c[U00_0000000000 000n0T0000k0[W0f0[LW0~0Y00 FREE 0000n0zzM0[ϑ GOTO 000 00000Qn00000g0c[U00f0D00Lx06R_0yRW0~0Y00 HELP ReactOS 0000n0000`1X0cOW0~0Y00 HISTORY O(uU00_0Y0y0f0n000000Nh:yW0~0Y00 IF 000 00000-Ng0agNQt0[LW0~0Y00 LABEL 0000n000000 0000h:y~0_0o0 YfW0~0Y00 MD 0000000\ObW0~0Y00 MKDIR 0000000\ObW0~0Y00 MKLINK Creates a filesystem link object. MOVE 00000yRJ00s00000h0000000 T0 YfW0~0Y00 PATH [LS0000n0i"}000h:y~0_0o0-[W0~0Y00 PAUSE 000 00000n0Qt0NBf\PbkW00000000h:yW0~0Y00 POPD s(Wn00000000 PUSHD 0000g0aU00_0000000k0 YfW0~0Y00 PROMPT 0000 000000 YfW0~0Y00 PUSHD s(Wn00000000OX[W00c[W0_0000000k0 YfW0~0Y00 RD 0000000JRdW0~0Y00 REM 000 0000k00000 (lȑ) 02W0~0Y00 REN 1 d0~0_0o0pen00000n0 TMR0 YfW0~0Y00 RENAME 1 d0~0_0o0pen00000n0 TMR0 YfW0~0Y00 RMDIR 0000000JRdW0~0Y00 SCREEN 00000yRU0[0~0Y00yR_0eW[R0eQRY00S0h00g0M0~0Y00 SET tX Ype0h:y0-[0~0_0o0JRdW0~0Y00 SHIFT 00000yRU0[0~0Y00yR_0eW[R0eQRY00S0h00g0M0~0Y00 ;START %Rn0000000wRW00c[W0_000000~0_0o000000[LW0~0Y00 TIME 0000Bf;R0h:y~0_0o0-[W0~0Y00 TIMER 10 P~0g0n0000000000OF0S0h0L0g0M0~0Y00 TITLE 0000 00000 00000n000000 00000-[W0~0Y00 TYPE 0000 0000~0_0o00000n0Q[0h:yW0~0Y00 VER ReactOS n0000000h:yW0~0Y00 VERIFY 0000L00000k0ckW0O0fM0~00_0S0h00gqTY00K0i0F0K00 c:yW0~0Y00 VOL 0000n000000 000h00000juS0h:yW0~0Y00  dziaBajcy na %s& Wolumin w napdzie %c ma etykiet: %s- Wolumin w napdzie %c nie posiada etykiety. & Numer seryjny woluminu to: %04X-%04X aWy[wietla etykiet woluminu w danym napdzie (o ile istnieje) i jego numer seryjny. VOL [napd:]"Zmienia wymiar i pozycj danego okna konsoli WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['tytuB'] /POS okre[la poBo|enie i rozmiary okna MIN minimalizuje okno MAX maksymalizuje okno RESTORE odtwarza standardowe ustawienia oknaZmienia wymiar i pozycj okre[lonego okna konsoli ACTIVATE 'tytuB' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['nowy_tytuB'] window tytuB okna, na ktrym zostan przeprowadzone zmiany /POS okre[la poBo|enie i rozmiary okna MIN minimalizuje okno MAX maksymalizuje okno RESTORE odtwarza standardowe ustawienia okna title nowy tytuB okna  %d plik(w) skopiowano skasowanozBe okre[lenie zmiennej.nieprawidBowy numer kolumnynieprawidBowy numer rzduStoper %d czas - %s: Lista wszystkich dostpnych komend (+opisy) komenda /? Wy[wietla dokBadny opis danej komendy ? Lista wszystkich dostpnych komend (bez opisw). ALIAS Ustawia, pokazuje lub usuwa aliasy. ATTRIB Wy[wietla lub zmienia atrybuty plikw. BEEP SygnaB przez gBo[nik PC. CALL WywoBuje program wsadowy z poziomu innego. CD Wy[wietla [cie|k lub przechodzi do innego katalogu. CHCP Wy[wietla lub ustawia bie|c stron kodow. CHOICE Przedstawia u|ytkownikowi kilka mo|liwo[ci i czeka na wybr. CLS Czy[ci ekran. CMD Uruchamia kolejne okno konsoli ReactOS. COLOR Ustawia kolory tBa i tekstu w oknie konsoli. COPY Kopiuje jeden lub wicej plikw w inne miejsce. DATE Wy[wietla lub ustawia dat. DELETE Kasuje jeden lub wicej plikw. DIR Wy[wietla list plikw i podkatalogw w danym katalogu. ECHO Wy[wietla wiadomo[ci albo wBcza/wyBcza komend ECHO. ERASE Kasuje jeden lub wicej plikw. EXIT Zamyka bie|ce okno konsoli. FOR Wykonuje okre[lon komend dla ka|dego pliku z okre[lonej listy. FREE Wolne miejsce na dysku. GOTO Kieruje interpreter poleceD do okre[lonej linii, oznaczonej, w danym programie wsadowym. HELP Lista komend konsoli ReactOS wraz z opisem. HISTORY Lista u|ytych komend. IF Przetwarzanie warunkowe w programach wsadowych. LABEL Tworzy, zmienia lub kasuje etykiet woluminu w danym napdzie. MD Tworzy katalog. MKDIR Tworzy katalog. MKLINK Creates a filesystem link object. MOVE Przenosi jeden lub wicej plikw z jednego katalogu do drugiego. PATH Wy[wietla lub ustawia [cie|ki dostpu dla programw. PAUSE Zawiesza przetwarzanie programu wsadowego i wy[wietla komunikat. POPD Odtwarza poprzedni nazw danego katalogu, zapisan przez PUSHD. PROMPT Zmienia znak zachty w linii poleceD. PUSHD Zapisuje obecn nazw katalogu, po czym zmienia j. RD Usuwa katalog. REM Oznaczenie linii komentarza w programie wsadowym. REN Zmienia nazw pliku lub plikw. RENAME Zmienia nazw pliku lub plikw. RMDIR Usuwa katalog. SCREEN Przenosi kursor i opcjonalnie wy[wietla tekst. SET Wy[wietla, ustawia lub usuwa zmienne [rodowiskowe. SHIFT Przenosi zamienne parametry w programach wsadowych. START Uruchamia oddzielne okno do wykonania okre[lonego polecenia lub komendy. Wykonuje polecenie. TIME Wy[wietla lub zmienia czas systemowy. TIMER Pozwala na u|ycie do 10 stoperw. TITLE Ustanawia tytuB dla danej sesji CMD.EXE. TYPE Wy[wietla zawarto[ pliku tekstowego. VER Wy[wietla wersj systemu ReactOS. VERIFY Decyduje czy ReactOS ma sprawdza poprawno[ zapisu plikw na dysku. VOL Wy[wietla etykiet woluminu na danym napdzie i numer seryjny.  70?CI5= =0 %s$ ">< 2 CAB@>9AB25 %c 8<55B <5B:C %s $ ">< 2 CAB@>9AB25 %c =5 8<55B <5B:8 !5@89=K9 =><5@ B><0: %04X-%04X 1K2>48B <5B:C B><0 8 A5@89=K9 =><5@. VOL [48A::]5=O5B 284 >:=0 :>=A>;8 WINDOW [/POS[=]left,top,H8@8=0,2KA>B0] [MIN|MAX|RESTORE] ['703>;>2>:'] /POS C:07K205B @07<5@ 8 ?>;>65=85 >:=0 MIN A2>@0G8205B >:=> MAX @072>@0G8205B >:=> RESTORE 2>AAB0=02;8205B >:=> e5=O5B 284 >:=0 :>=A>;8 ACTIVATE 'window' [/POS[=]left,top,H8@8=0,2KA>B0] [MIN|MAX|RESTORE] ['703>;>2>:'] window 703>;>2>: >:=0, 284 :>B>@>3> A;54C5B <5=OBL /POS C:07K205B @07<5@ 8 ?>;>65=85 >:=0 MIN A2>@0G8205B >:=> MAX @072>@0G8205B >:=> RESTORE 2>AAB0=02;8205B >:=> 703>;>2>: =>2K9 703>;>2>: %d D09;(>2) A:>?8@>20=> wiped =5?@028;L=>5 7040=85 ?5@5<5==>9.=5?@028;L=>5 7=0G5=85 4;O :>;=5?@028;L=>5 7=0G5=85 4;O AB@Timer %d is %s: ) !?8A>: 2A5E 4>ABC?=KE :><0=4 A :>@>B:8< >?8A0=85< :><0=40 /? K2>48B ?>4@>1=CN 8=D>@<0F8N > :><0=45 ? !?8A>: 2A5E 4>ABC?=KE :><0=4 157 >?8A0=8O. ALIAS K2>4, CAB0=>2:0 8;8 C40;5=85 ?A524>=8<>2. ATTRIB K2>4 8 87<5=5=85 0B@81CB>2 D09;>2. BEEP 2C:>2>9 A83=0;. CALL K7>2 >4=>3> ?0:5B=>3> D09;0 87 4@C3>3>. CD K2>4 8<5=8 ;81> A<5=0 B5:CI53> :0B0;>30. CHCP K2>4 8;8 A<5=0 B5:CI53> =><5@0 :>4>2>9 AB@0=8FK. CHOICE 45B, ?>:0 ?>;L7>20B5;L =5 2K15@5B >48= 87 C:070==KE 2 A?8A:5 A8<2>;>2. CLS G8AB:0 M:@0=0. CMD 0?CA: =>2>9 :>?88 8=B5@?@5B0B>@0 :><0=4. COLOR #AB0=>2:0 F25B>2 ?> C<>;G0=8N 4;O B5:AB0 8 D>=0. COPY >?8@>20=85 >4=>3> 8;8 =5A:>;L:8E D09;>2 2 4@C3>5 <5AB>. DATE K2>4 8;8 87<5=5=85 40BK. DELETE #40;5=85 >4=>3> 8;8 =5A:>;L:8E D09;>2. DIR K2>4 A?8A:0 D09;>2 8 ?>4:0B0;>3>2 :0B0;>30. ECHO K2>4 A>>1I5=89 8 ?5@5:;NG5=85 @568<0 >B>1@065=8O :><0=4 =0 M:@0=5. ERASE #40;5=85 >4=>3> 8;8 =5A:>;L:8E D09;>2. EXIT 025@H05B 8=B5@?@5B0B>@ :><0=4. FOR 0?CA:05B C:070==CN :><0=4C 4;O :064>3> D09;0 87 =01>@0 D09;>2. FREE (!2>1>4=>5) 48A:>2>5 ?@>AB@0=AB2>. GOTO 5@540G0 C?@02;5=8O A>45@60I59 <5B:C AB@>:5 ?0:5B=>3> D09;0 HELP @54>AB02;O5B A?@02>G=CN 8=D>@<0F8N > :><0=40E ReactOS. HISTORY !?8A>: 70?CI5==KE :><0=4 IF ?5@0B>@ CA;>2=>3> 2K?>;=5=8O :><0=4 2 ?0:5B=>< D09;5. LABEL !>740=85, 87<5=5=85 8 C40;5=85 <5B>: B><0. MD !>740=85 :0B0;>30. MKDIR !>740=85 :0B0;>30. MKLINK Creates a filesystem link object. MOVE 5@5<5I5=85 D09;>2 8 ?5@58<5=>20=85 D09;>2 8 :0B0;>3>2 PATH K2>4 8;8 7040=85 ?CB8 ?>8A:0 8A?>;=O5<KE D09;>2. PAUSE @8>AB0=>2:0 2K?>;=5=8O ?0:5B=>3> D09;0. POPD >ABB0=02;8205B ?@54K4CI55 7=0G5=85 B5:CI59 48@5:B>@88 A>E@0=5==>5 :><0=4>9 PUSHD. PROMPT 7<5=5=85 ?@83;0H5=8O :><0=4=>9 AB@>:8. PUSHD !>E@0=O5B B5:CICN 48@5:B>@8N, 0 ?>B>< <5=O5B 55. RD #40;5=85 :0B0;>30. REM 0?8AK205B :><<5=B0@88 (70<5G5=8O) 2 ?0:5B=KE D09;0E. REN 5@58<5=>20=85 >4=>3> 8;8 =5A:>;L:8E D09;>2 8;8 :0B0;>3>2. RENAME 5@58<5=>20=85 >4=>3> 8;8 =5A:>;L:8E D09;>2 8;8 :0B0;>3>2. RMDIR #40;5=85 :0B0;>30. SCREEN 5@5<5I5=85 :C@A>@0 8 2K2>4 B5:AB0. SET K2>4, 7040=85 8 C40;5=85 ?5@5<5==KE A@54K. SHIFT 7<5=5=85 A>45@68<>3> (A4283) ?>4AB02;O5<KE ?0@0<5B@>2 4;O ?0:5B=>3> D09;0 START B:@K205B >B45;L=>5 >:=> 4;O 70?CA:0 C:070==KE :><0=4 8;8 ?@>3@0<<. K?>;=O5B :><0=4C. TIME K2>4 8;8 87<5=5=85 2@5<5=8. TIMER !5:C=4><5@. TITLE 7<5=5=85 703>;>2:0 >:=0 :><0=4=>9 AB@>:8. TYPE K2>4 A>45@68<>3> >4=>3> 8;8 =5A:>;L:8E B5:AB>2KE D09;>2. VER K2>4 25@A88 !. VERIFY :;NG5=85 8;8 >B:;NG5=85 @568<0 ?@>25@:8 ?@028;L=>AB8 70?8A8 D09;>2 =0 48A:. VOL K2>48B <5B:C B><0 8 A5@89=K9 =><5@.  running on %s Volume in drive %c is %s " Volume in drive %c has no label. # Volume Serial Number is %04X-%04X NDisplays the disk volume label and serial number, if they exist. VOL [drive:] change console window aspect WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the windowcchange console window aspect ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile of window on which perform actions /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the window title new title % %d sbor(ov) skoprovan(ch) wipedbad variable specification.invalid value for colinvalid value for rowTimer %d is %s: ( Zoznam vaetkch dostupnch prkazov (+ popis) prkaz /? Pre viac informci o konkrtnom prkaze ? Zoznam vaetkch dostupnch prkazov (bez popisu). ALIAS Sets, removes or shows aliases. ATTRIB Displays or changes file attributes. BEEP Ppnutie reproduktora. CALL Calls one batch program from another. CD Displays the name of or changes the current directory. CHCP Displays or sets the active code page number. CHOICE Waits for the user to choose one of a set of choices. CLS Vyma~e obrazovku. CMD Starts a new instance of the ReactOS command interpreter. COLOR Sets the default console foreground and background colors. COPY Skopruje jeden alebo viac sborov na in umiestnenie. DATE Displays or sets the date. DELETE Deletes one or more files. DIR Displays a list of files and subdirectories in a directory. ECHO Displays messages, or turns command echoing on or off. ERASE Deletes one or more files. EXIT Quits the CMD.EXE program (command interpreter). FOR Runs a specified command for each file in a set of files. FREE (free) disc space. GOTO Directs the ReactOS command interpreter to a labeled line in a batch program. HELP Provides Help information for ReactOS commands. HISTORY List all commands which has been used IF Performs conditional processing in batch programs. LABEL Creates, changes, or deletes the volume label of a disk. MD Creates a directory. MKDIR Creates a directory. MKLINK Creates a filesystem link object. MOVE Moves one or more files from one directory to another directory. PATH Displays or sets a search path for executable files. PAUSE Suspends processing of a batch file and displays a message. POPD Restores the previous value of the current directory saved by PUSHD. PROMPT Changes the command prompt. PUSHD Saves the current directory then changes it. RD Removes a directory. REM Records comments (remarks) in batch files. REN Renames a file or files. RENAME Renames a file or files. REPLACE Replaces files. RMDIR Removes a directory. SCREEN Move cursor and optionally print text. SET Displays, sets, or removes ReactOS environment variables. SHIFT Shifts the position of replaceable parameters in batch files. START Starts a separate window to run a specified program or command. Executes command. TIME Displays or sets the system time. TIMER Allow the use of ten stopwatches. TITLE Sets the window title for a CMD.EXE session. TYPE Displays the contents of a text file. VER Displays the ReactOS version. VERIFY Tells ReactOS whether to verify that your files are written correctly to a disk. VOL Displays a disk volume label and serial number.  berjalan pada %s! Volume dalam drive %c adalah %s & Volume dalam drive %c tidak berlabel $ Nomor Seri Volume adalah %04X-%04X EMenampilkan label dan nomor seri volume disk, jika ada. VOL [drive:]mengubah aspek jendela konsol WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS menetapkan penempatan dan dimensi jendela MIN mengecilkan jendela MAX memaksimalkan jendela RESTORE mengembalikan jendelaemengubah aspek jendela konsol ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile jendela yang melakukan aksi /POS menetapkan penempatan dan dimensi jendela MIN mengecilkan jendela MAX memaksimalkan jendela RESTORE mengembalikan jendela title judul baru  %d file di-copy dihapus spesifikasi variabel tidak baik.Nilai untuk kolom tidak benarNilai untuk baris tidak benarTimer %d adalah %s: Daftar semua perintah yang tersedia (+ deskripsi) command /? Untuk informasi lengkap pada perintah tertentu ? Daftar semua perintah yang tersedia tanpa deskripsi. ALIAS Menyetel, menghapus atau menampilkan alias. ATTRIB Menampilkan atau mengubah atribut file. BEEP Membunyikan speaker. CALL Memanggil program batch dari yang lain. CD Menampilkan nama atau mengubah direktori saat ini. CHCP Menampilkan atau menyetel nomor halaman kode aktif. CHOICE Menunggu pengguna untuk memilih satu dari set pilihan. CLS Membersihkan layar. CMD Memulai instan interpreter perintah ReactOS baru. COLOR Menyetel warna standar latar belakang dan depan konsol. COPY Mengcopy satu atau lebih file ke lokasi lain. DATE Menampilkan atau menyetel tanggal. DELETE Menghapus satu atau lebih file. DIR Menampilkan daftar file dan subdirektori dalam sebuah direktori. ECHO Menampilkan pesan, atau menghidupkan/mematikan echo perintah. ERASE Menghapus satu atau lebih file. EXIT Keluar dari program CMD.EXE (interpreter perintah). FOR Menjalankan perintah tertentu untuk setiap file atau set file. FREE (bebas) ruang disc. GOTO Melangsungkan interpreter perintah ReactOS ke baris berlabel dalam program batch. HELP Menyediakan informasi Bantuan untuk perintah ReactOS. HISTORY Mendaftarkan semua perintah yang sudah digunakan IF Melakukan pemrosesan kondisional dalam program batch. LABEL Membuat, mengubah, atau menghapus label volume disk. MD Membuat sebuah direktori. MKDIR Membuat sebuah direktori. MKLINK Creates a filesystem link object. MOVE Memindahkan satu atau lebih file dari satu direktori ke yang lainnya directory. PATH Menampilkan atau menyetel path pencarian untuk file executable. PAUSE Menunda proses file batch dan menampilkan pesan. POPD Mengembalikan nilai sebelumnya dari direktori saat ini yang disimpan oleh PUSHD. PROMPT Mengubah prompt perintah. PUSHD Menyimpan direktori saat ini lalu mengubahnya. RD Menghapus direktori. REM Merekam komentar (remarks) dalam file batch. REN Mengganti nama file. RENAME Mengganti nama file. RMDIR Menghapus direktori. SCREEN Memindahkan kursor dan secara opsional mencetak teks. SET Menampilkan, menyetel, atau menghapus variabel lingkungan ReactOS. SHIFT Mengangkat posisi parameter yang bisa diganti dalam file batch. START Memulai jendela terpisah untuk menjalankan perintah atau program tertentu. Menjalankan perintah. TIME Menampilkan atau menyetel jam sistem. TIMER Mengijinkan penggunaan sepuluh stopwatch. TITLE Menyetel judul jendela untuk ses CMD.EXE. TYPE Menampilkan isi dari file teks. VER Menampilkan versi ReactOS. VERIFY Memberitahu ReactOS apakah memverifikasi bahwa file anda ditulis dengan benar ke sebuah disk. VOL Menampilkan label volume disk dan nomor seri.  running on %s Volume in drive %c is %s " Volume in drive %c has no label. # Volume Serial Number is %04X-%04X NDisplays the disk volume label and serial number, if they exist. VOL [drive:] change console window aspect WINDOW [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the windowcchange console window aspect ACTIVATE 'window' [/POS[=]left,top,width,heigth] [MIN|MAX|RESTORE] ['title'] window tile of window on which perform actions /POS specify window placement and dimensions MIN minimize the window MAX maximize the window RESTORE restore the window title new title %d D09;(V2) A:>?V9>20=> wipedbad variable specification.=5?@028;L=5 7=0G5==O col=5?@028;L=5 7=0G5==O row"09<5@ %d - %s: S !?8A>: 2AVE 4>ABC?=8E :><0=4 (+ >?8A) :><0=40 /? ;O 4>:;04=>W V=D>@<0FVW ?@> :>=:@5B=C :><0=4C ? !?8A>: 2AVE 4>ABC?=8E :><0=4 157 >?8AC. ALIAS AB0=>2;5==O, 2840;5==O 01> ?>:07 ?A524>=V<V2. ATTRIB V4>1@065==O 01> 7<V=0 0B@81CBV2 D09;C. BEEP 2C:>289 A83=0; A?V:5@0. CALL 8:;8: >4=VTW ?0:5B=>W ?@>3@0<8 7 V=H>W. CD V4>1@065==O V<5=V 01> 7<V=0 ?>B>G=>W ?0?:8. CHCP V4>1@065==O 01> 2AB0=>2;5==O ?>B>G=>3> =><5@0 :>4>2>W AB>@V=:8. CHOICE GV:C20==O 281>@C :>@8ABC20G5< >4=>3> 7 2:070=8E A8<2>;V2. CLS G8I5==O 5:@0=C. CMD 0?CA: =>2>W :>?VW V=B5@?@5B0B>@0 :><0=4 ReactOS. COLOR AB0=>2;5==O B8?>28E :>;L>@V2 B5:ABC V B;0 :>=A>;V. COPY >?VN20==O >4=>3> 01> 1V;LH5 D09;V2 2 V=H5 <VAF5. DATE V4>1@065==O 01> 2AB0=>2;5==O 40B8. DELETE 840;5==O >4=>3> 01> 1V;LH5 D09;V2. DIR V4>1@065==O A?8A:C D09;V2 V ?V4?0?>: 2 ?0?FV. ECHO V4>1@065==O ?>2V4><;5=L, 01> ?5@5<8:0==O @568<C 2V4>1@065==O :><0=4. ERASE 840;5==O >4=>3> 01> 1V;LH5 D09;V2. EXIT 8EV4 7 ?@>3@0<8 CMD.EXE (V=B5@?@5B0B>@0 :><0=4). FOR 0?CA: 2:070=>W :><0=48 4;O :>6=>3> D09;C 7 =01>@C D09;V2. FREE (V;L=89) 48A:>289 ?@>ABV@. GOTO 5@540G0 C?@02;V==O @O4:C ?0:5B=>W ?@>3@0<8, O:89 <VAB8BL <VB:C. HELP >2V4:>20 V=D>@<0FVO ?@> :><0=48 ReactOS. HISTORY !?8A>: CAVE 28:>@8AB0=8E :><0=4. IF ?5@0B>@ >1@>1:8 C<>2 C ?0:5B=8E ?@>3@0<0E. LABEL !B2>@5==O, 7<V=0, 01> 2840;5==O <VB>: B><C 48A:0. MD !B2>@5==O ?0?:8. MKDIR !B2>@5==O ?0?:8. MKLINK Creates a filesystem link object. MOVE 5@5<VI5==O >4=>3> 01> 1V;LH5 D09;V2 7 >4=VTW ?0?:8 4> V=H>W ?0?:8. PATH V4>1@065==O 01> 2AB0=>2;5==O H;OEC ?>HC:C 28:>=C20=8E D09;V2. PAUSE "8<G0A>25 ?@8?8=5==O >1@>1:8 :><0=4=>3> D09;C V ?>:07 ?>2V4><;5==O. POPD V4=>2;NT ?>?5@54=T 7=0G5==O ?>B>G=>W ?0?:8, 715@565=5 :><0=4>N PUSHD. PROMPT <V=0 70?@>H5==O :><0=4=>3> @O4:0. PUSHD 15@V30T ?>B>G=C ?0?:C, 0 ?>BV< 7<V=NT WW. RD 5@5<VI5==O ?0?:8. REM 0?8ACT :><5=B0@V (70C2065==O) 2 :><0=4=8E D09;0E. REN 5@59<5=C20==O D09;0 01> D09;V2. RENAME 5@59<5=C20==O D09;0 01> D09;V2. REPLACE 0<V=0 D09;V2. RMDIR 5@5<VI5==O ?0?:8. SCREEN 5@5<VI5==O :C@A>@0 V 282545==O B5:ABC. SET V4>1@065==O, 2AB0=>2;5==O, 01> 2840;5==O 7<V==8E >B>G5==O ReactOS. SHIFT @CH5==O ?>78FVW 70<V==8E ?0@0<5B@V2 C :><0=4=8E D09;0E. START V4:@820T >:@5<5 2V:=> 4;O 70?CA:C 2:070=8E :><0=4 01> ?@>3@0<. 8:>=CT :><0=4C. TIME V4>1@065==O 01> 2AB0=>2;5==O A8AB5<=>3> G0AC. TIMER >72>;OT 28:>@8AB0==O 45AOB8 A5:C=4><V@V2. TITLE AB0=>2;5==O 703>;>2:0 2V:=0 4;O A5AVW CMD.EXE. TYPE V4>1@065==O 2<VABC B5:AB>2>3> D09;C. VER V4>1@065==O 25@AVW ReactOS. VERIFY :;NG5==O 01> 2V4:;NG5==O @568<C ?5@52V@:8 ?@028;L=>ABV 70?8AC D09;V2 =0 48A:. VOL V4>1@065==O <VB:8 B><C 48A:0 V A5@V9=>3> =><5@0. Ungltiger Operand. Erwartet ')'.$Erwartet Nummer oder Variablennamen. Syntaxfehler./Unterverzeichnis oder Datei existiert bereits. Ersetzt Dateien. REPLACE [Laufwerk1:][Pfad1]Dateiname [Laufwerk2:][Pfad2] [/A] [/P] [/R] [/W] REPLACE [Laufwerk1:][Pfad1]Dateiname [Laufwerk2:][Pfad2] [/P] [/R] [/S] [/W] [/U] [Laufwerk1:][Pfad1]dateiname Bezeichnet die Quelldatei(en). [Laufwerk2:][Pfad2] Bezeichnet den Pfad in dem die Dateien ersetzt werden sollen. /A Fgt neue Dateien dem Zielpfad hinzu. Kann nicht mit /S oder /U Parameter genutzt werden. /P Wartet auf Besttigung bevor eine Datei ersetzt oder eine Quelldatei hinzugefgt wird. /R Ersetzt schreibgeschtzte Dateien. /S Ersetzt Dateien in allen Unterordnern des Ziel- pfades. Kann nicht mit Parameter /A genutzt werden. /W Wartet vor dem Start bis ein Datentrger eingelegt wurde. /U Ersetzt (aktualisiert) nur Dateien, die lter sind als die Quelldaten. Kann nicht mit Paramater /A genutzt werden Quellpfad bentigt Keine Dateien ersetzt %lu Datei(en) ersetzt Ersetze %s Ersetze %s Keine Dateien hinzugefgt %lu Datei(en) hinzugefgt Fge %s hinzu (Y/N) Operador errneo. Se esperaba ')'. ,Se esperaba un nmero o nombre de variable. 'La sintaxis del comando es incorrecta. Directory is not empty! 'A subdirectory or file already exists. +The path to the new folder does not exist. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) Oprande invalide. Attendu ')'."Attendu nombre ou nom de variable.)La syntaxe de la commande est incorrecte.Le rpertoire n'est pas vide! .Un sous rpertoire ou un fichier existe dj. 3Le chemin vers le nouveau rpertoire n'existe pas. CRemplace les fichiers. REPLACE [lecteur1:][chemin1]nomdefichier [lecteur2:][chemin2] [/A] [/P] [/R] [/W] REPLACE [lecteur1:][chemin1]nomdefichier [lecteur2:][chemin2] [/P] [/R] [/S] [/W] [/U] [lecteur1:][chemin1]nomdefichier Spcifie le ou les fichier(s) source. [lecteur2:][chemin2] Spcifie le rpertoire o les fichiers doivent tre remplacs. /A Ajoute les nouveaux fichiers dans le rpertoire de destination. Ne peut tre utilis avec /S ou /U. /P Demande une confirmation avant de remplacer un fichier ou d'ajouter un fichier source. /R Remplace les fichiers en lecture-seule aussi bien que les fichiers sans protection. /S Remplace les fichiers dans tous les sous-rpertoires du rpertoire de destination. Ne peut tre utilis avec /A /W Attend que vous insriez un disque avant de commencer. /U Remplace (met jour) uniquement les fichiers qui sont plus anciens que les fichiers sources. Ne peut tre utilis avec /A. Chemin source requis Aucun fichier remplac %lu fichier(s) remplac(s) Remplace %s Remplace %s Aucun fichier ajout %lu fichier(s) ajout(s) Ajouter %s (Y/N) Operando non valido.Attesa una ')'.(Attesa un numero o un nome di variabile.!La sintassi del comando errata.La cartella non vuota! Una cartella o file esiste gi. -Il percorso della nuova cartella non esiste. sSostituisce i file. REPLACE [disco1:][percorso1]nomefile [disco2:][percorso2] [/A] [/P] [/R] [/W] REPLACE [disco1:][percorso1]nomefile [disco2:][percorso2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]nomefile Specifica il o i file sorgenti. [disco2:][percorso2] Specifica la cartella dove i file devono essere sostituiti. /A Aggiunge i file alla cartella di destinazione. Non pu essere usato con /S o /U . /P Chiede conferma prima di sostituire o aggiungere un file. /R Sostituisce sia i file in sola lettura che quelli non protetti. /S Sostituisce i file in tutte le sottocartelle della cartella di destinazione. Non pu essere usato con /A . /W Aspetta che sia inserito un disco prima di iniziare. /U Sostituisce (aggiorna) solo i file pi vecchi dei file sorgenti. Non pu essere usato con /A . $Il percorso sorgente obbligatorio Nessun file sostituito %lu file sostituiti Sostituzione di %s in corso Sostituzione di %s Nessun file aggiunto %lu file aggiunti Aggiungere %s (S/N) Ugyldig operand.Forventet ')'.%Forventet nummer eller variabel navn.Syntaks for kommandoen er feil.Mappen er ikke tom! )En undermappe eller fil finnes allerede. *Stien til den nye mappen eksisterer ikke. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) Invalid operand. ')'.&    .'      .Directory is not empty! 'A subdirectory or file already exists. +The path to the new folder does not exist. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch.   -     %lu ()     %s   %s    %lu ()   %s (Y/N) Invalid operand. Expected ')'.!Expected number or variable name.'The syntax of the command is incorrect.Directory is not empty! 'A subdirectory or file already exists. +The path to the new folder does not exist. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) !qRj000000g0Y00 Expected ')'!Expected number or variable name.0000n0ieL0Uc0f0D0~0Y00000000L0zzg0o0B00~0[00! "Y0g0k0000000Qk000000000K00000L0X[(WW0f0D0~0Y00 eW0D00000x0n000L0X[(WW0f0D0~0[000 SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) !NieprawidBowy argument operatora.Oczekiwano ')'.%Oczekiwano liczby lub nazwy zmiennej.$SkBadnia komendy jest nieprawidBowa.Katalog nie jest pusty! /Istnieje ju| plik lub podkatalog o tej nazwie. 0Zcie|ka do nowego katalogu nie jest prawidBowa. 525@=K9 >?5@0=4.68405BAO ')'.(68405BAO G8A;> 8;8 =0720=85 ?5@5<5==>9.525@=K9 A8=B0:A8A :><0=4K.0B0;>3 ?CAB! $>4:0B0;>3 8;8 D09; C65 ACI5AB2C5B. &CBL : =>2><C :0B0;>3C =5 ACI5AB2C5B. Invalid operand.O akvan ')'.&O akvan slo alebo nzov premennej.Nesprvna syntax prkazu.Directory is not empty! 'A subdirectory or file already exists. +The path to the new folder does not exist. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) Operand tidak benar.Diharapkan ')'.%Nomor atau nama variabel diharapkan.Sintaks perintah tidak benar.Direktori tidak kosong! "Subdirektori atau file sudah ada. Path ke folder baru tidak ada. 52V@=89 >?5@0=4.GV:CTBLAO ')'."GV:CTBLAO G8A;> 01> V<'O 7<V==>W.5:>@5:B=89 A8=B0:A8A :><0=48.Directory is not empty! 'A subdirectory or file already exists. +The path to the new folder does not exist. SReplaces files. REPLACE [drive1:][path1]filename [drive2:][path2] [/A] [/P] [/R] [/W] REPLACE [drive1:][path1]filename [drive2:][path2] [/P] [/R] [/S] [/W] [/U] [drive1:][path1]filename Specifies the source file or files. [drive2:][path2] Specifies the directory where files are to be replaced. /A Adds new files to destination directory. Cannot use with /S or /U switches. /P Prompts for confirmation before replacing a file or adding a source file. /R Replaces read-only files as well as unprotected files. /S Replaces files in all subdirectories of the destination directory. Cannot use with the /A switch. /W Waits for you to insert a disk before beginning. /U Replaces (updates) only files that are older than source files. Cannot use with the /A switch. Source path required No files replaced %lu file(s) replaced Replacing %s Replace %s No files added %lu file(s) added Add %s (Y/N) Ersetze %s (Y/N) Fge %s hinzu (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 9 Ctrl-Break pressed. Cancel batch file? (Ja/Nein/Alle) Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 8 Ctrl-Break pressed. Cancel batch file? (Si/No/Todos) Remplacer %s (Y/N) Ajoute %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 9 Ctrl-Break pressed. Cancel batch file? (Oui/Non/Tous) Sostituire %s (S/N) Aggiunta di %s in corso (Link simbolico creato per %s <<===>> %s #Hard link creato per %s <<===>> %s "Junction creato per %s <<===>> %s Avanti? 8 Ctrl-Break. Interrompere il file batch? (Si/No/Tutti)Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 8 Ctrl-Break trykket. Avbryt batch filen? (Ja/Nei/Alt)  %s (Y/N)    %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) Loads a DLL. DLL [drive:][path]filename DLL /A address /K Do not unload the DLL (FreeLibrary) after loading it (LoadLibrary) /M Use MemoryLoadLibrary in stead of LoadLibrary /A Use MemoryLoadLibrary and load from given hexadecimal address TDisplays info for given file. INFO [drive:][path]filename /X To be defined. OEnable privileges. The privileges enabled by this command are: SE_BACKUP_NAME (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? : Ctrl-Break pressed. Cancel batch file? (Igen/Nem/Mind) Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? ; Ctrl-Break pressed. Cancel batch file? (Tak/Nie/Zawsze) (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s Viac? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? ; Ctrl-Break pressed. Cancel batch file? (Ya/Tidak/Semua) Replace %s (Y/N) Adding %s (Symbolic link created for %s <<===>> %s $Hard link created for %s <<===>> %s #Junction created for %s <<===>> %s More? 7 Ctrl-Break pressed. Cancel batch file? (Yes/No/All) Tim Norman Matt Rains Evan Jeffrey Steffen Kaiser Svante Frey Oliver Mueller Aaron Kaufman Marc Desrochers Rob Lake John P Price Hans B Pufal a Eric Kohl Emanuele Aliberti Paolo Pantaleo Phillip Susi Sylvain Petreolle h 00@@(HHhH  00 @@(2 HHH@      00 (@@ DHH XPP h``  4VS_VERSION_INFO  ? StringFileInfo040904b0RCompanyNameReactOS Development Team\FileDescriptionReactOS Command Processor.FileVersion0.3.11(InternalNamecmd.OriginalCopyrightCopyright (C) 1994-1998 Tim Norman and others~-LegalCopyrightCopyright (C) 1998-2006 Eric Kohl and others8OriginalFilenamecmd.exeRProductNameReactOS Operating System2ProductVersion0.3.11DVarFileInfo$Translation )))@ ' 8G[G>G[LDG[MHG[NUG[ObG[ShG[Tit[jtntstyttttt t5:55:=;ABDUUVX\QRS%T&b+d,1 61H 7cH9cH>cHEcHGcH%VcH-XcH0[cH1^cHmcH rcHycH(o{o{o{o{o{o{o{{&/25:@BJNZ]_dnv%,9KNSYagz|##'()+-,/1,#%-465>>SC[>^RmSpRsSvT}UVZ`f`fgKgjIKIKL NRSU0[3U5Z8[>ERJTEWJbcxghLq}%+5;>FT_bilrz #)18 : CFLP ^` bdlt7{7{7{7{7{7{!7{$?[U+?[Y2?[U4?[W7?[Y9?[[@?[^E?[_G?[^N?[_X?[`c?[do?[e}?[Y?[hG[GOGOGOGOGOGOGOkO&ku'ku&ku&ku'ku*ku+ku(u`Oc*Od0OnBOoGOfQOg\Oh^OzgOqmOsvOw|O OOOOOOOOOOOOOOOO!O2OKOdOwOOOOOOOOOOOOOOOOOOO OO#O.O7O<ACGJNUYeikp !#!#""#$#9:<=>@ AEB.A=CFEMEOFeHyJKPH$.!$.%$.$.($./$.)$.*$.+$.,$./$.1$.3 $.4 $.3$.;#$.'$.@:$.BS$.Dd$.Lm$.Q$.S$.U$.]$.n$.{$.~$.b$.d$.p/$.uO$.wZ$.rfFanFdqFf|FFiFoFkFlFmFoFsFFsFuFFwFFFBFPFeFtFFFFFFFFFFFF F* P`<. P`<0 P`>6 P`G= P`>? P`3M P`BO P`@Q P`BX P`C^ P`De wej w|l wem w|o weu wx} w| wy w| w w w w w w w w!w!!w5!wD!wL!wU!wb!wk!wn!wt!wz!w!w!w!w!w!w!w!w!w!w!w!w!w!w"w"w"w"w!"w*"w7"wA"wJ"wP"wV"w\"w_"wa"wg"wl"wn"w"w"w"w"w"w"w"w"w#w#w#wR#wp#&s#(~#)#*#)######$ $$$$$0$E$H$K$N$T$Z$]$`$e$j$r$z$}$$$$$$$$$$$$ %%%%%#%)%,%4%7%:%=%C%I%L%T%]%z%|%%%% % %%%%%%K&N&K &N&OR&S\&f&m&s&u&&&&&&&'#'T'\'`''''`'`'`'`'`'`'`'`'`'`'3'8(;(<(J$(86(??(@E(CK(FT(G_(Ak( {n( {x( {( {(4{(4{(4{(4{(C]W(C][(C]W(C][(C]](C]a(C]c(C]d(C]e(C]d(C]e(C]g)C]h)C]j)C]h)C]j))C],)C]r>)C]tI)C]vS)C]xc)C]zf)C]xl)C]yr)C]zu)C]y)C])C])C])C])C]])C]a)C]c)C]d)C]e)C]d)C]e*C]g *C]h*C]j*C]h%*C]l3*C]a7*C]lH*C]~Y*C]s*C]*C]r*vu.*vu/*vu.*vu.*vu/*vu2*vu3*vu0*u*u*u*u*u*u+u ++%+)*+A+M+T+[+d+$i+%l+$n+%s+&|+!+++1+4+ +1+$+%+&+'+$+%+*+++*++,,,.",-,,.8,1A,.R,j^,on,pz,q,r,q,r,s,r,s,w,,,,,w,z-{-}-&-2-~>-  L- (Q-  W- (\- *a- (c- *i- ,n- *p- ,v- ;x- ,~- ;- t- ;- H- O- Q. T. X. T. W. T. W!. X3. [9. `<. \?. ]E. ^K. \R. _Y. `c. bf. cj. bq. d. g. o. q. r. k. l.&{.&{.&{/&{ /&{/&{/&{/&{/&{%/6{Y1/6{^C/6{_^/6{bw/6{d}/6{f/6{g/6{m/6{u/6{v/6{u/6{v/6{{/6{|/6{}/6{~06{b06{o06{p,06{q:06{xF06{yH06{P0B{+W0B{,`0B{2p0B{3}0B{60B{?0B{S0B{90B{;0KT;0KT<0KT;0KT<0KT?0KT<0KT?0KTD0KTE0KTJ0KT@1o< 1o@)1oBB1oDE1oCO1oD_1oFi1}s1}1} 1}!1}$1}%1}&1})1}*1}+2},2}-/2}.72}7:2}.?2}7A2M2P2^2j2m2p2u2222222222&2&2'2*2+2'2(2'2A2F3A 3F 3J3L.3M83S@3FK3HS3FW3Qe3Ms3M3Q3S3U3Z3^3_3Q3c33 3 33 33333444&4%'4 -4!34"94#?4$E4%G4'N4%P4'V4)\4*c4+k4 44445-5'V5 L`5 Lc5 Pj5 Ss5 V|5 R}5 W5 a5 e5 f5 Y5 \5 e53h53h53m53p53r53m53536363v63|$6H*6HT.6HT06HT;6HTA6HTP6HTR6VTZ6VT\6VTb6VTu6VTy6VT6VT6VT6VT6VT6VT6VT6VT6VT6VT6VT6VT6dT6dT6dT6oT6oT6oT6zT6zT7zT 7zT7zT7T7T7T7T#7T%7T*7T67T;7T*B7T+K7T.U7T/^7T0e7T1j7Tq7T z7T#7T$7T%7T&7T57T67T777777777x7y7{7}888"8.898<8C8I8R8V8c8Hj8Hl8Iw8J8K8L8M8N8S8V8S8T8V8U8V8X8Y8X8Y9[9W9Z295989<9J9L9P9S9W9Z9]9g9m9u9{x9|{9}~9~99999u9u9u9u9u9u9u9!u9!9!9!9!9!9!:!:!:!:!':!9:!@:!R:!i:-{q:-{u:-{w:-{}:-{:-{:-{:3H:3H:3H:3H:3H:3H:3H:3H:3H:3H:3H;3H ;3HB;7HI;7HQ;7H_;7He;7Hh;@Hk;@H{;@H;@H;@H;@H;M?;M>;M@;MA;M@;MA;MB;MF;MH;MI;MD;Z[;Z\;Z^;Z]<p<p<p<pI<p!<p'<p-<pK0<pJ7<pL9<pA<pMF<pP<pY<~_<~a<~f<~h<~j<~l<~<~!<~<~<~<~<~<~<X<]<_<a<f<g<f<g=i=k=m#=n+=iE=qW=uc=ww=y=z=u=~====[=[=[=[>[>[>[>['>[9>[F>[i>[u>[{>[>[>[>[>[>[>[>{>{>{>{>{>{>{>{>{?{?{?{?{*?{-?{0?{2?{6?{;?{J?{N?{ Q?{ U?{ i?{ ?H4?H6?H?H?H?H?H?H9?Ho?H?H @H@H@H/@H2@H7@H=@H@@HG@HI@HT@Hu@H=~@HD@H\@H_@Hj@H?@HF@HR@HS@HT@HI@HbAH AH AHAHAHAH'AH/AH4AH>AHCAHFAHLAHQAHSAHZAHcAHfAHrAH|AHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAHAAAAABB BB%B,B1B3B>BTB^BbB tmB TvnB TtqB TvvB TxxB Tv{B TxB T}B TB TB TB TB TB TB TB TC T C TCTlCTmCTlCTl"CTm'CTl+CTm3CTn5CTCCTeCTjC(TpC(TsC(TyC(T|C(TC(TC(TC5TC5BC5BC5BC5BC5BC5BC5BC[WC[VC[WD[X D[Y DfbDfBe4DfBfBDfBgEDfBhHDfBgRDfBhTD|BcD|BiD|B!mD|B&oD|B$yD|B&{D|B(~D|B)D|B(D|B)D|B*D|B-D|B9D|B<D|B-D|B8D|B9D|B1E|B2E|B3$E|B;3EsAE|IEsOE|UE}\EcE}lEnE{EEEEEEEEEEEEEEEF'F9FFFWFxFFFFFFFFFFFFFFFGGGG&'G/8G0:G/HTHTHTHTHTHTHTHBHBHBHBHBzHB{HB|IB}I BMI BNI BOI BP I$ BF#I$ BF'I$ BG/I$ BH;I$ BI=I9 B?@I9 B?DI9 B@LI9 BAXI9 BBZIP BX`IP T[cIP T\iIP T[lIP T\qIP T]tIP T^vI] g I] g I] g I] g I] g I] g I] g I] g I] g I *I 1I *I 1I 2I 5I 2J 5 J SJ V0J W;J _MJ lSJ m[J 8mJ :zJ ;{J :}J ;J CJ OJ FJ NJ FJ JJ KJ LK Y!K Z(K b;K dK kK TMK TRK TQK TRK TSK TTK TUK $L ' L )L ,L -L <#L 'GL )JL 1SL 3XL 1ZL 6fL 1iL 3kL 1nL 3sL 6vL 3xL 6L !L !L #L %L &L 'L (L *L ?L . M 9M ;-M <1M 04M 1FM 2KM 3QM 5YM <]M 1bM 0eM 1vM 5M 6M @M 9M =M TM TM TM TM TM TyM TzM T{M T0M T6M T7N T@N TG5N TH,c {A.c {>3c {?=c {ADc {B^c {;gc {Ec {Gc {oc {Ic c %c c % d d +d Gd Yd ud d d d d d d d +d .d `d d e e 0e ye e e e e e e e e e f f %f -f Lf Pf cf zf f f f f f f f f g g )g 8g Ig aYg dg g g g g g g g hg tg g g h jh p2h ~8h @h ~Fh Lh ch kh h h h h h h 8i Hi di si i i i 1i 2i 3i 8i ;i <i Bi Ei Gj Hj Gj Hj L&j [7j \Bj >Gj Lqj Q{j Rj Sj Uj Vj Nj HTj HVj HTj HVj HYk Hmk Hn!k H\-k Hd>k HeJk HfRk HiVk Hqek H{gk Hlk Hrwk H{k H|k H{k Hk k k k k k k k! k! k! k! k! k! k! l! l! l! {l! |l! }l! ~l! %l! 1l! @l! JGl! KJl! LLl! Ul! MZl! dl! nl! l! l! l! Jl! Kl! Ll! Ml1 l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]l1 ]m1 ]#m1 ]5m1 ]8m1 ]@m1 ]qm1 ]m1 ]m1 ]m1 ]m1 ]m1 ]m1 ]m1 ]m1 ]m1 ] n1 ]!n1 ]'n1 ])n1 ]3n1 ];n1 ]=n1 ]?n1 ]Hn1 ]Tn1 ]Zn1 ]rn1 ]{n1 ]n1 ]n1 ]n1 ]n1 ]n1 ]n1 ]nE {oE {#oE {&oE {(oE {.oE {6oE {9oE {;oE {UoE {ZoE {^oE {`oE {hoE {{oE {oE {oO {foO {moO {noO {moO {poO {roO {soO {xoO {yoO {xoO {~ pO {x pO {)pO {,pO {0pO {~BpO {GpO {OpO {jpO {opO {qpO {spO {}pO {pO {pO {pO {pO {pO {pO {pO {pO {pO {pZ $pZ *pZ $pZ *pZ - qZ .qZ -qZ .qZ 3!qZ 4)qZ 5.qZ 60qZ 53qZ 65qZ <:qZ @SqZ @\qZ AgqZ C|qZ TqZ 0qZ 8qZ 9qZ :qZ EqZ GqZ HqZ AqZ IqZ JrZ M rZ N rZ QrZ Srg {)rg {.rg {1rg {=rg {Hrg {Krg {!Qrg {#Xrg {$crg {)rrg {*{rg {)rg {*rg {)rg {/rg {0rg {3rg {6rg {)rg {0sg {6sg {7sg {3Bsg {;Jsg {XUsg {=ssg {>xsg {=zsg {>sg {Bsg {Csg {Dsg {Esg {sg {sg {sg {sg {sg {tg { tg {tg {&tg {.tg {[tg {jtg {ltg {ntg {tg {tg {tg {tg {tg {tg {tg { tg { tg {Htg {Xug {E(ug {Q=ug {SMug {TWug {UZug {_bug {iug {ug {ug {Jug {\ug {^um {@um @um _um gum eum gum jvm gvm j'vm mAvm tWvm arvm buvm vm mvm tvm {vm jvm tvm ~vm vm vm vm vm wm wm wm wm $wm .wm 5wm ?wm Fwm Pwm Uwm `wm ewm lwm wwm wm wm wm wm wm wm wm wz xwz ywz xwz ywz wz ywz xz xz xz 0xz 9xz Axz Kxz Xxz dxz exz mxz xz xz xz xz xz xz xz xz xz xz xz xz yz yz 2yz ?yz Tyz ]yz jyz ~yz yz yz yz yz y `y cy `y cy dy cy iy jy iy jz lz mz l!z p4z gJz tSz v]z uaz mz pz sz vz }z !z "z #z 'z (z +z /z 2{ 5{ 2{ 5{ B%{ ;.{ <7{ BB{ Da{ Fw{ Iz{ #{ ,{ /{ Z{ [{ _| `| _ | `| d&| jB| S| Y| g| }| | | | | | |  } 7} G?} MR} P`} Ql} Sz} U} V} /} _} U} V} c} d} } j} o~ w=~ yN~ wT~ x~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~  1 C M S X b               % - = C E F H Q n      | } ~΀ ր          ' , 3 5 B sK [sQ [tu [w| [}~ [t [} [ [ [ [y [Á [ʁ [ҁ [}ց [ [ [ [ [! [* [0 [: [@ [M [W [[ ^  d  i  k >r    ! )̂ /ނ 2    $. %6 +@ 7X 9g k `m `s `x ` ` ` ` " Ƀ Ѓ "Ճ $ك * , 4 6 = D G" D$ G2 I5 G7 I< JD LK RO XT RX &e .m /w [ 8 9 ? @ N TÄ WƄ X˄ Wф X  ++{+{+{%+{.+{ E+{"J+{#O+{%Y+{)h+{.j+{%p+{*w+{%6T6T6T6T6T6T6T6T6TÅ6Tƅ6Tȅ6Tڅ6T݅6T6T6T 6T6T6T6T6T6T6T&6T.6TE6TQ6TT6T\6Tc6T}6T6T 6T FF#F"FÆF"ƆF#̆F&چF)܆F$PWPWP`/Pc=PiLPsUPt^PuxPz{PuPyPzP~PPg҇PzՇPg߇PyPgPzP~P"P`#P+P`3Pm;P{XP``t```````È`Ɉ`ӈ```````(`0`K`N`P`h`q`t`~```````ˉ````` ``` `7`R`g`````Ê`֊````m"m5(m@m5lm=mFmGmFmGmOmFmO‹mSՋmTًmSۋmTmYEmKmUmnmsmymmmmmmm7Ìm8̌m?ٌm@ڌm?m@mAmBmImmmIGmTm]mm`čmaɍm`ύmaэmtmymmm mmmm!m-m3mDmcMmfYmgimdnmgtmd{mcm{m|ɎmԎmݎmmmmm m1m8mNmQmSWm]mSkmT~mZm\m]ƏmϏmُmmm mmmm*m0m6m<mBmHmZmkmTymUmZm.m0ʐmZאmfmkmmm.m1ma<m0Zm.`m6fm>m9mkmpőmmmm/m5m8mPmYm\m_memmmʒmؒmmm"m-m3m4m<m=m@mSm[mmmmӓmߓmmmmm!m,m8mRmfmqmmsmmŔmmm9mQm^mamcmhmmmmmܕmmm m m+ua1uTf3uTe6uTf:uTe=uTfEuTgHuTiJTXTrT}TTAABEBEKMƖT͖UޖGHGHnOP _P_#=1K7X;miVab,3ȗ̗ϗ &, "#-(():;>^ ;A^ @F^ >P^ @]^ Bk^ Cm^ {r^ Fw^ I^ L^ M^ O^ R^ U^ `^ eØ^ jɘ^ mӘ^ nݘ^ o^ p^ X^ u^ Z^ c ^ h^ t%^ u+^ x9#E-G#J-O/W-]/j5p;~=;=?127|™{̙|֙?=?=E*G7OOMYOaUdOfUlfyhjG֚IJEW `#a+b5c:v]xpy ɛכۛ(.(.(.(.(.(.(.(.(.!(.9(.I(.U(.W(.a(.c(.f(.k(.{(.(.(.(.(.(.˜(.ܜ(.(.(.((.0(.6(.<(.E(.O(.U(.[(.c1&s1&1A͝1Eٝ1J1M1N1O1T1_1d@1&O1CX1Ee1Gm1Hn1Gv1V1W1Y1Z1[1]1bў1h1l1o1p1q'1s)1q+1s51t81s>1tG1wT1xV1>`1tr1zz1|1~1111Ɵ1Ο11111%171I1u1111111Р1۠1ݠ1111111(121C1L1R1Y1_1q1{1"11$1'1)ơ10Ρ12ء131<11(1A1Q1X1^1h1l1{11111111Ȣ1111!131C1P1 c1i1p1w1{11 1 11Σ1111F1111,1-1.17ؤ1Q;*;E(;E(;E*;E,;E4;E2%;E4+;E;=;ECI;EMX;ENm;E*;E=;E?;E>;EO;ESå;E.ѥ;E/ե;E7;EE;EJ;EE;EG;EH;EO^l^l^l.^l8^l!J^l"O^l[^l\^l^^l_^leg^l$q^l*{^l+^l-^l3^l9^l:^l<Ǧ^lBѦ^lC^lE^l>^lJ^lP)^lQ.^lS4^l_7^lYA^l_M^lYW^l_\^lbl0x0{9:;<Cϧ<֧CۧDCDLPRP Rv",;Ypsu{ʨը)1FAVNYTrayg|v}\fg©kȩlҩgکoz%+9?EP]cp|˪Ԫ" '7?EHJP[`p~ ɫ Ы)14 7473897:9A7KA[CfK~dgEFKϬP߬QSVWY"[(Y.[7]A_N`Q_W`hk x!"jjroryzyzyĭ}ǭzۭyz}&t2u3t5u61>KyŮծۮ}3:KS_k{¯Яү   -9BDJOW(`+m/װ +7GOZdis}" )5ͱ5бYر7߱Ydadf df#o.r?]M^OwWtdvovy}Ʋϲֲݲ$6=@Xlͳ+7=a| 7iBlOtb˵ֵ/w׶f) -HSY#_/b0l2q зӷַ ۷&޷%&()*16 8%D)E:KGNTSaX|^`;=?@ָK P*Z5n>qKo^e/ h/ }/ / / / / / Ĺ/ ҹ/ ׹/ / ,,-39</$0(52?7:F(M&Q&T(V*k0q3v5{8(1,-ź!*%ɺ!*%̺!*'!*0!*-!*0!*I!*M!*O!*)+!**,!*).!**/!*T6!*5G!*6M!*5O!*6Y!*7`!*<i!*9z!*>!*?!*>!*?!*B!*C!*E!*JɻBWٻBWܻBvBBBBBBBB"B<BEBSBUB]BwBBBBBBBBҼBBBB BBFB_BlBBBBBBBBBѽB޽BBBBB@BpBBBBBBʾBBBB BB,B>BBB GB RBgBuB|BBBӿBBBBBB(B5B<B PB!eB"sB#B$B&B*B/B5BIBUBW/B\8BqCBrNBscBB&B,BBBB8B:B=B?&BA4BCABDHBFPB8B@BCBLBNBQBOBQBLBU Bb-Bl?BxLB{YBqBBBBBBBBBeBfBg BiBfBg$Bl6BxHB{UB;fB<mB~BBBBBBBBBBBBBBBBBB:B<BKBXBZB`BbBcBfBkBzBBBBBBBBBBBBB1BMBhB{BBBBBBBBBBBBBB B'B-B3B@BFBTBfBrBBBBBBBBBBBBBBBBBBBB#KY/KYJKY$_KY&aKY$cKY&iKY)oKY(yKY)|KY9KY=KY>KY9KY:KY?KY:KY;KY<KY=KY>KY?)KYARKYF\KY hKY!lKY/pKY.wKY/|KY0KY1KY2KY3KY0KY1KY4KY5KY6KY1KY2KY3KY4KY5KY6s}s}s}s}&s}s}!s}#s}&(s}-:s}8Ks}9Qs}?Ts}9Xs}<hs}?ys}Fs}]s}(s})s}es}/s}0s}/s}1s}2s}8s}9s}<s}?s}<s}?s}Fs}]1s}A6s}BJs}His}Lys}Rs}Vs}Xs}Zs}Ns}_s}`} )-0Ec mt"+.:;EFTadv| )3BHMas;;>DEDEMNP @A`"G)I*H4I@RJX^TiZsNv^|_  $+DLO[ nr{g )}g g "g )g +g 1g 7g 9g 7g 9g ;g <g =g -g 3g g @g B g D'g E2g NLg \kg ]xg ^g _g bg dg eg dg eg fg hg jg lg ng pg tg rg tg v g wg vg wg .g 4g Ng [g ig xg g Gg Hg Ig Jg Kg Pg Qg Rg Sg Tg U g Vg Wg X.g g>g iNg k^g mng yg zg g g g g g g 65568/>;@@6j:x;|(,*,.5:BCD,(0618y@<J=T>WE\KdHkKRTZ\]M\^ bc$f%h'f-h6jHkTqxvwXX^dfgmo mo*p3>$?BGJM$b`nau&*-+*+-+-5<AJM"P(J/MJPcS01o89ru6' 6&6&6'6))6/561:6'd6+r6,v> E}> B> E> I> J> E> L> R> X> N > O> UJi$Ji'Js@JyJJXJ[JrJ{JJJJJJJJJuJvJ{JJJ!JHJPJVJ[JaJtJJJJJRRRRRR RR RRdRR@RLRTRZR]R`RfRiRtRR:R<R>R@RBRDRFRHRJRLRNRO R\R%R7R/;R3?R5QR"SR ZR!aR"cR#lR&pR'yR*R+R6R;R=R?RARCRERGRIRKRM,RP2RW8RX9RW;RCRQRSUR\nRitRk~RRwRrRvRtRiRtRuR|R}R|R}RRRR RR R(R}/R?RKRSR_RiRoRuR{RRRRRRRRRRR RRRRRRRRRRRRRR RRR$R5R>RGRMRSRYRcRmRwRRRRRRRRRRRRRRRRR RRR"R)R3R:RBRHRORYRdRsRyRRRR__+_.________  _!_"_#_$%_%,_&3_':_(A_)G_.P_6k_8z_____/_6_=_G_D_G_H_J_L_a_Z _R_S_T2_Z4_b@_cR_>n_@s_x_@____H_Z_[_a_[_\2_]a_^___`_a7_:_cf_bl_dy_o_w_y_z___ _d0_eE_oj_r___J_e_f1_gd_h_i_u__>_D%_E*_Hg_Pz_W_X_\_]_}_R_S_Jjw"jw%jw:jwDjwJjw$_jw'bjw*ijw+rjw.wjwjwjw jw*jw+we w e m w |      % 4 A V[ Wl Xx ~  ~  '                     ( 1 5 G T W Z f x                  ( 0 9 A J U b i r "}           $ 4 = CLOdpz5FZ_ju & 45 HP Q_ Ni Qn Rs Qu R{ U W U W a e g i e J K B Y Z Y Z [; lP nZ o[ ea qv s v x { }       " e, < J M k q z         - 4 : E Q Z f o x          & E J L R [ j {               0 < 6H &f 6o & $ & , 6 8 =( H+ I. H; J@ G \ h      & 5 &H (Z &b 2x A J M O T U Z `$ i8 ~Q j }          B  W Y! X+ Y5 Z= bK d_ ns t n p n ~    " 9 L c r        4 7 : < > ?& A U h q              " < I #y . / 0                 % & 5 W h o     ' % ' ( '- D- G- O- M- O(- X7- oN- vh- {- - I- R- S- R- S- T- - Z- [- Z- [- `)- eS- ]j- bu- g- q- r- s- x- {- x- {- - }- ~- 3Z !6Z "BZ #QZ $S!V"m-t0x$%,.W6Zy    B+HNUZai"p!x'&2CEHIJIJMKM P1C<6M7X9b:l<~=>?NU ")/5;AHMYehrCCdefhxz|kl klmlm7 8*q>rN[\_x!MSY`n 1@FHW_m:IWd t!&+3&-03@ F L RX ^{#$#$()-. 5 7$ ! - ! 3 !< !C !I !O !V !c !e !g !i !y !! !" !# !! ! ! !' !) !+ !- !, 3; 3Q 3; 3Q 3 3 3; 3= 3B 3QP 3h 3j 3t 3W 3X 3Y 3X 3Y 3Z 3[ 3Z 3] 3^ 3a 3b 3d% 3e+ 3b0 3fC 3hY 3n^ 3ou 3p 3q 3p 3q 3t 3u 3t 3u 3w 3y 3{D 3|` 3}c 3{f 3} 3~ 3} 3~ 3 3 3 3 3v 3xC 3zk 3v 3x 3z 3 3 3 3 3 3 333 3(3T333;>;E;>;E;H;I ;J';O3;Q@;SS;RZ;Sf;Zn;[q;\y;L;V;WHHHH.H0HH"H#H$H% H&H'H()H);H*BHXHkH{HHHHHHHHHHHHHH H H H H H HHH6H:H@HQHaHcHiHtH~HHHHHH#H$H%H&H11H.8H4?T<HT<NTATTCeTeoTCuTYTCTFTGTFTGTHTGTHTMTJTKT_`i`t`i`t`i`t`y`{`}$`+`1`3`6`H`R`Y`c`g`i`k`r```````````````` ````"`0`;`B`E`K`k`x`}`````````` ``` `"`.`4`?`C`F`u````````````` `"`%`(`+`:`G`O`Y`ho1wo6o9o:oBo9o?oA7u7uOuQuRuQuRuTuVugMuXWuYupu{uburutuwuxuu|u}u~u uuO%uXuOb"k#r(t#v(.<*+@21258h|h|/1<BKUZhj5rt+5:DM\_agu{  #-DHKPfv}~22* 2 < A1C E1J4M1O4f8v;};@!((5+C,F+H,W.Z0[.`0e2z0i"q($!$&$&.1323P)+*3+87@9C7E9GAQHWI\JfMq;z<=C                   "  6  K  Y  ^  k  w  y    h  a  b  d  h  j  p  r  x  z  |  }! |! }! ! ! z#! t0! 7! G! Q! Z! b! j! w! ! ! ! ! ! ! ! ! " " " " #" +" ;"D"G"\"f"l"""."0"1""""<"="<"="A#B#A #B #G#I(#R<#KB#MM#NS#O[#o#u#}##W#W#]#W#]#^#]#^#b#c#b#c#h#i#k#i#k#l#k$l$r$&${4$}:$C$Q$e`$fc$k$no$t~$u$$$$$$$$$$$$$$$%%%%%%*%5%=%B%H%Z%t%% %% %% %% %% %% %% %% %% %% %% %% %% %% %% %% %% %% %% &% H&% W&% ,[&% -e&% \n&% ^{&% b&% d&% e&% &% &% &% &% '% '% '% )'% /'% 1'% B'% H'% N'% \'% ]'% f'% t'% '% -'% 4'% M'% O'% P'% R'% U'% V'% O'% V'% (% (% &(% .(% 4(% 9(% T(% p(% x(% }(% ~(% (% (% (% (% (% (% )% )% )% )% %)% @1)% BB)% CO)% Dg)% s)% )% )% )% )% )% )% )% ")% #)% ")% #)% ")% #)% )% )% )% *% *% %*% /*% E*% L*% b*% e*% h*% m*% x*% ~*% *% *% *% *% *% *% *% *% *% *% *% +% +% !+% (:+% F+% *Q+% +U+% *V+% +\+% -d+% ,j+% -o+% .+% /+% 5+% 7+% 9+% 7+% 8+% 9+% 8+% 9+% +% +% +% +% ,% ,%  ,% &,% *,% .,% 2,% 8,% A,% P,% V,% [,% h,% s,% ,% ,% ,% ,% ,% ,% ,%  -% -% -% #-% .-% ?-% B-% F-% Z-% `-% z-% ~-% -% -%H -% -% -% -% -% -% -% -%  .%  .% #.% 2.% I.% S.% i.% t.% z.% .% .% .% .% .% .% .% .% .% .% .% .% .% .% .% /% 4/% 81/% 9Z/% i/% @m/% Ap/% @q/% Au/% @z/% 9/% </% =/% B/% C/% F/% G/% H/% I/% D0% N0% P$0% Q?0% SR0% dY01Lh01Qo01Lr01Qt01q{01r01v01w01S01Z01U01\01^01b01d01]01h01v01j 11k1:71:41:71:?/1:@51:B91:E@1:DF1:EH1:GZ1:Ln1:Rw1:S|1:81:J1D 1D1D1D1D1M^1Md1M^1Md1M^1Md1M^1Md1M1Md1M1M1M1M1M1Mi2Mk2Mn2Md,2Mf52Mg92MA2MI2MkY2Mub2M|l2M~u2M2M2M2M2M2Mu2M~2M2M2M 3M3M3M03M<3MI3MP3M]3Mc3Mk3Mu3M3M3M3M3M3M3M3M3M3M3M3M3M3M4M4M4M4X*4X:4XG4XZ4Xh4Xp4Xt4Xv4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X4X5X5X5X5X:5X@5XB5XI5XO5X U5X `5X e5X h5X j5Xr5i5i5i5i5i5i5i5i"5i$5i&6i,6i"6i$)6i&66i,=6iSG6ih6i4q6i5v6i?{6iA6i.6i76i=6i96i:6i;6i6iK6i6iK6iI6iK7iP 7iL 7iK7iM7iP7iN7iO(7iP07iQT7z_7zd7zl7zn7zp7z7z7z7zW7zZ7z\7z^7za7z7zd7zm7z|7z~7zh8zp8zq&8zr*8zs18zv;8zwE8zvL8zQ8zV8z_8zd8zq8z~8z8z8z8z"8z8z8z!8z8z8z8z"8z%8z&8z(8z)8z28z58z+8z-8z78z:9z<9z"9z)9z+9z-9z/9z@9zB9zE9zL9zO9zR9zY9z[9zg9zp9zy9z~9z9z9z999999999999999: ::':.:9:I:[U:[\:[v:[}:[:[:[:[:[:[:[:[:[:[:[ :[ :[ :[:[:[ :[;[;[*;[6;[<;[S;[k;[n;[t;[;[!;[%;[&;[*;[,;[-;[,;[-;[2;[;;[<;[=;[<;[=;[=<[B<[V<[`<[h<[n<[p<[z<[<[<[ <[ <[<[<[ <[<[<[D<[<[<[<[<[ =[=[+=[1=[9=[B=[Q=["_=[2v=[4=[5=[6=[7=[8=[@=[B=[@=====>>>>3>6>m>>>>>>>>>>>@>=>@>D?P;?R>?NL?RV?P\?e?r??????????????@4@X:@Y=@X@@YA@XC@YI@ZS@[[@\h@_@s@t@s@t@z@}@~@}@~@@@GAXAYAXAYAZ(A[-A\5A_KAb_AnlAfuAg{AhAiAfAjAmAjAmAvA~AAAAABB BBHB^BiB|BBBBBBBBBBBBBBBC CC%CACKCUCaCdC!|C#CCCCDDSDDDDDDDD+D+D-E4E7E/!E&E+E2EBEKEME\EfEtEEEEEEEEEEEEEEEEEEF FFF"F(F+F-F3F@FcBFdDFcIFdMFcSFdaFvzF}F~FFFFFFFmFoFFFFFFFGG GGGGG&G-G/G6G8G>GAGNGTG^GiGlGvG~GGGGGGxGGGGCGHGJGKHJHK HNHOHNHO HU.Hb6Hg>HsFHRHZH'fH(iH'oH(|H1HHHHHQHRHYHZHYHZH`HHHII(I\.I]2Ie@IjLIkOIjQIkZIqhImnInIoIvIxI{I|I{I|IIxIII*I+I*I+J.J$J.J8JBJLJVJhJnJJuJIyJI{JJJLJNJOJPJSJTJSJTJMJxJxJyJZ K{K}9KAKMKaKgKyK}KKKKKKZKKKK LLOL\LtLLLLLLLLLLLLLLLMZMM,MVMZaMtMMMMMMMMMMMMM NNNN"N%N+N7N?NGN`N{NNNNNNNNNNO\OkOzOOOOOOOOP+P>PQP ^PdPiPqPPPPPPPP$P%P$P%P(P*P6P7P8P:PZQVQ&Q;QJQ]QcQkQwQyQQQQQQQQQQQQQQRR-RNRZR_RaRcRnRRRRRRRRRRRRRRRRSS&S8SWS]S^SaSSSSS S SSSSSSSST!T!+T*?T>LT?RT>UT?`T@rTBvTE~THTJTHTJTLTMTFTQTTTUTW UaUeUa%Ue1Uf@UgLUfOUgWUf\UibUjxUZUjUmUnUmUnUjUUUV V,V/V,V.V/V.V/ V1&V2'V1)V20V59VKV\VcVlV qVVVVV(V(V(V(V(V(V(V(V(V(V(W( W(#W(  W(#"W(%4W(*8W(+9W(*?W(+DW(.NW(/SW(0UW(/ZW(0`W(3fW(TkW(SuW(TzW(YW(ZW(YW(ZW(\W(]W(\W(]W(`W(cW(dW(cW(dW(jW(dW(jW(tW(xW(X(X(X(X(X(%X(OX(^X('nX((tX(1X(kX({X(zX({X(X(X(Y(Y(Y(IY(WY(eY(sY(Y(Y(Y(Y(Y(Y(Y(Y(Y(Y(Y( Z(Z()Z(+Z(.Z(/Z(5Z(BZ(QZ(rZ(vZ(Z(~Z(Z(Z(Z(Z(Z(Z(>Z(Z(Z([([(#[($([(%/[('A[(%F[()O[(8][(9t[()[(/[(.[(/[([([([([([([([([([([(\(\(%\(*\(1\(6\(E\(>Z\(@e\(Am\(Bu\(\(\(\(\(\1'\1:,\1:'\1:,\1:-\1:4\1:5 ]1:R]1:,=]1:/K]1:0O]1:9a]1::f]1:9j]1:<q]1:>u]1:@]1:>]1:@]1:<]1:D]1:G]1:E]1:G]1:P]1:G]1:J^1:L^1:M^1:L!^R0^RA^RF^RI^RJ^RL^RR^RV^Rl^R^R^R^R^R^R^R^R^R^R_R_R_R!_R'_R1_RD_RN_Rm_Rz_R_R_R_R _R_R_R_R_R_R_R_R_R_R_R`R`R`R`R`R$`R,`RF`RS`RW`R\`Rr`Rw`Rz`R`R`R`R`R`R`R`[G`[H`[J`[H`[J`[K`[N`[M`[N`[Sa[Ya[a"a[c=a[aBa[PFa[QVa[[\a[\aa[]ba[\da[na[Ura[Va[ea[ka[la[ka[a[a[a[a[a[a[a[rb[s b[rb[sb[v.b[|9b[~Tb[|Yb[vcb[xwb[b[b[bcbc`bc`bc`bc`bc`bc`bc`bc`bc`3bc`4bc`cc` cc`-cc`Ucc`Xcc`]cc`_cc`gcc`jcc`rcc`wcc`cc`cc`cc`3cc`cc`cc`cc`cc`cc`3cc`4cc`cc`cc`3cc`4cc`cc` dc`dc`-dc`4dc`7dc`:dc`Hdc`Odc`]dc`fdc`ndc`vdc`~ds`ds`ds`ds`ds`3ds`ds` ds` ds`ds`d}`d}`d}`d}`d}`d}`d}`3e}`4e}` e}`e}`%e}`1e}`2e}`9e}`?e}`ge}`oe}`{e}`e}`e`e`e`e`e`'e`+e`5e`e`3e`e`e` e`"f`# f`%f`8f`3f`4"f`)5f`/\f`0`f`/if`0uf`9yf`8f`:f`>f`>f`?f`Bf`Df`3f`Ef`Gf`If`Vf`Wg`Y g`Lg`Og`R!g`J-g`J0g`OEg`3Qg`4Vg`Qdg`Rfg`ng`Xrg`kg`xg`3g`4g`Zg`[g`Zg`[g`^g``g`ag`bg`dg`ng`3h`4 h`3h`h`%h`s1h`u>h`Kh`Yh`oh`{vh`|yh`{{h`|h`}h`h`h`h`h`h`h`h`h`h`h`h`h`h`h`i` i`i`!i`2i`l ?l Al Bl Cm0$!m0&'m0'+m0*:m0-Bm0UGm0VIm0WLm0XNm0[Rm0]Vm0jam0mim0ntm0xm0 |m0m01m02m03m06m0am0m0m0m0m0m0m0m0n0.$n0+8n0Hn0Tn0ken0qn0 |nU9}nU9nU9nU9nU9nU9nU9nb93nb9nnb9-nb9.nb9/nb90nb93nb9onb9pob9sob9ob9ob96ob97$ob9E&ob9o-ob9q1ob9t=ob9vCob9tMob9vTob9zYob9~eob9pob9}ob9:ob9;ob9Cob9Eob9>ob9@om9om9om9omom9om9om9om9pm9pm9pm9pm9)pm93pm9?pm9Gpm9cpm9hpmspm9}pm9pm9pm9pm9pm9pm9pm9pm9pm9pm9pm9pm9pm9qm9qm90qm9=qm9Aqm9Kqm9Pqm9Zqm9_qm9}qm9qm9qm9qm9qm9qm9qm9 qm9qm9qm9qm9qm9qm9qm9qm9qm9rm9 rm9rm9 !rm9'rm9 )rm9.rm9Erm9Prm9[r9^r9hr9mr9rr9tr9wr9r9r9r9r9Lr9Qr9Lr9Qr9r9Qr9sr9r9r9Qr9r9r9r9r9Us9V s9]s9`s9Zs9h's9i.s9p2s9s6s9mFs9Os9\s9ls ps7KqsiKtsiKsiKsxKsxKsxKssss sssssssss ss s"sssssstKtKtK.tK6tK=tKStKZtK]tKqtKstKN|tKNtKRtKYtK]tK`tKatK`tKatKbtKatKctKdtKftKguKTuKU%uKV4uKW9uKAuKYCuK\NuK]cuK`muKgyuKouKpuKiuKjuKkuKluKmuKsuKuuKtuKuuKfuKyuKzuK|uK~uK}uK~uKuKvK vKvKvK$vK$7vK&LvK'MvK&PvK'VvK(YvK'[vK(^vK)zvK+|vK,vK4vK:vK8vK9vK:vK;vKvK vK!vK"vKIwK$wK&#wK,2wK57wK.@wK/JwK+PwK0YwK1bwK2kwK@mwK?swK@uwKBywKD|wKCwKDwKFwKGwKHwKwK wK wK wK wK w$Kw$Kw$Kw$Kw$Kw$Kw$Kw4Kw4Kw4Kx4Kx4K)x4K>x4KNx4KWxEK^xEKaxEKfxEKixEKoxEKuxEKwxEKxEKxEKxEKxEKxVK=xVK@xVKAx_Kx_Kx_Kx_Kx_Kx_Kx_Kx_Kx_Kx_Kx_Kx_Ky_Ky_K y_K y_Ky_Ky_K'y_K1y_KCy_KXy_K^y_Kay_Kky_Kty_Ky_Ky_Ky_Ky_Ky_Ky_Ky_Ky_Ky_Ky_Kz_K z_Kz_K$z_K%z_K*z_K, ,> ,,A,;,A&,H0,K3,M8,L:,H=,KB,LG,MQ,Ac,Rk,T,D,E,Y,[,a,],^,a,],^,a…,_ą,a؅,{,z,{,,, ,,[$,d',e),d,,e.,8,B,fL,iO,jY,i\,j^,h,y,k,,cF,cF(cF)cF,cF1cF6cF8cF6cF-ȆcF.ΆcF-ӆcF.߆cF1cF3cF;cF<cF;cF<uFC uFB uFCuFHuFEuFF!|F$|F/|F1|F:|FC|F!I|F"S|F$X Z\Tp @G[ @t@!@!@"@X"@1H#@o{H#@`%@'@ (@/@/@7{H0@?[R1@GO1@ku.2@Ox6@67@7@8@@9@$.<@FT@@P`@@wF@K@L@PO@`O@P@ {RQ@C]TU@vuV@W@|Z@ ]@&{ja@KT2b@od@le@e@f@g@j@ dk@3Hl@HTVo@r@r@s@us@!t@-{^u@3HXw@Mx@px@px@p-x@p9x@pAx@pFx@px@~{@[}@{@H@Ą@ T @5B·@[@fBf@֍@@T@B@P T@] g @ f@ T@ F@ @ @@ T@8 @D T @R `@ B0@ - @F TB@Q ^ @u T@ {@ [:@ BT@ @ @ :@ T|@# / @I Z P@v h@ @ T@ {h@ |@ H&@ @! @! @!  @! )@! .@! g@! N@1 ]@E {@Z :@g {~@m @z \@ @ A A [A A `6A A A+{ A6Th AFV,AuT-A/At0A^ r2A07A7A(.:A1IA;E LA^lNAcArA/ sAtAuA!*wABFAKY“As}AAg AAPAA6A> 6AJDARBc`BmBm9Bm)Bm9B7K.BBKbase/shell/cmd/main.cwmainDllMain@12obj-i386/base/shell/cmd/unit.cAddBatchRedirection./base/shell/cmd/batch.cFindForVar./base/shell/cmd/cmd.ccheck_redzone_region./base/shell/cmd/cmddbg.cReadSeparator./base/shell/cmd/date.cInitDirectoryStack./base/shell/cmd/dirstack.cGetDirectoryStackDepthHistory_move_to_bottom./base/shell/cmd/history.cPeekHistoryStripQuotes./base/shell/cmd/misc.cMemoryFreeLibrary./base/shell/cmd/memorymodule.cMemoryGetProcAddressConvertULargeIntegerwrite_redzoneMemoryLoadLibrarydebugstr_winclude/reactos/wine/debug.h_stpcpyFindArgtxt_clr./base/shell/cmd/strtoclr.cGetHandle./base/shell/cmd/redir.cchop_blankStringToColorGetParameter./base/shell/cmd/start.cIsSeparator./base/shell/cmd/parser.cGetNextElement./base/shell/cmd/for.cReadNumberParseTime./base/shell/cmd/time.cParseDateGetQuotedString./base/shell/cmd/set.cFindPrefixAndSuffix./base/shell/cmd/filecomp.cgetExt./base/shell/cmd/dir.cQsortFilesGetTimeString./base/shell/cmd/locale.cFormatTimeFormatDateident_lengetNameIsExistingDirectoryIsExistingFileSearchForExecutableSingle./base/shell/cmd/where.cSetHandleUndoRedirectionCurrentProcessAdjustToken./base/shell/cmd/privilege.cMakeFullPath./base/shell/cmd/internal.cDeleteFolderCreateJunction./base/shell/cmd/mklink.cIsValidPathNameGetPathCasecgetcharConInKey./base/shell/cmd/console.cGetDateStringInitLocaleGetRootPathgetPath./base/shell/cmd/replace.cGetDirectory./base/shell/cmd/move.cIsKeyInString./base/shell/cmd/choice.cRunFileParseHexAddress./base/shell/cmd/dll.cDirPrintFileDateTimeSetCursorTypeGetScreenSizeGetCursorYGetCursorXGetCursorXYSetCursorXYConInEnableConInDisableConInFlushcmd_exitredzone_errcheck_redzonecmd_checkbuffer_dbgcmd_free_dbginclude/ndk/rtlfuncs.hFreeRedirectionFreeCommandfreepdelset_sizeCleanHistoryPopDirectoryDestroyDirectoryStackcmd_alloc_dbgDuplicateEnvironment./base/shell/cmd/setlocal.ccmd_endlocalExitBatchFileGetStringHistoryHistory_del_current_entryInitHistorycompareConWriteConErrCharConPrintfConErrPrintferror_syntax./base/shell/cmd/error.cParseErrorerror_sfile_not_foundErrorMessageChangeAttribute./base/shell/cmd/attrib.cCallMemoryLoadLibraryConErrResPrintferror_invalid_parameter_formaterror_bad_commanderror_too_many_parameterserror_invalid_switcherror_parameter_formatConOutPrintfPrintTime./base/shell/cmd/info.cPrintAttributeConOutResPrintfPrintElapsedTime./base/shell/cmd/timer.cOnOffCommand./base/shell/cmd/echo.cPrintDateStringConPutsConErrPutsConOutFormatMessageConErrFormatMessageSetRootPathConErrResPutscalcseta_ltorTermseta_bitOrTermseta_bitExclOrTermseta_logShiftTermseta_addTermerror_out_of_memoryerror_no_pipeerror_invalid_driveerror_req_param_missingerror_file_not_founderror_path_not_foundSetScreenColor./base/shell/cmd/color.cConOutPutsShortVersion./base/shell/cmd/ver.cConOutResPutsCheckCtrlBreakReadBatchLinemsg_pauseCommandEchoserrCommandEchoerrCommandEchosCommandDirsCommandPopdCommandPushdcopy./base/shell/cmd/copy.cConOutCharPrintPrompt./base/shell/cmd/prompt.cPrintCommandList./base/shell/cmd/cmdtable.cCommandShowCommandsClearCommandLine./base/shell/cmd/cmdinput.cConInStringFilePromptYNAFilePromptYNProcessDirectory./base/shell/cmd/del.cCommandHistorycmd_dup_dbgcmd_realloc_dbgSearchForExecutableadd_entrysplitspacecmd_setlocalsplitCommandTimercmd_mklinkReadFileContentsCompleteFilenameGetEnvVarBatchParamsGetEnvVarOrSpecialseta_identvalPrintAssociation./base/shell/cmd/assoc.cRemoveBreakHandlerAddBreakHandlerPagePromptConPrintfPagingDirPrintfDirPrintNewListPrintSummaryDirListConOutPrintfPagingConOutResPagingcmd_vol./base/shell/cmd/vol.ccmd_verify./base/shell/cmd/verify.ccmd_vercmd_type./base/shell/cmd/type.ccmd_title./base/shell/cmd/title.ccmd_timecmd_startcmd_shift./base/shell/cmd/shift.cCommandScreen./base/shell/cmd/screen.creplacerecReplacerecFindSubDirsinvalid_switchcmd_replacecmd_rename./base/shell/cmd/ren.ccmd_promptcmd_privilegecmd_pause./base/shell/cmd/pause.ccmd_path./base/shell/cmd/path.ccmd_moveCommandMemory./base/shell/cmd/memory.ccmd_label./base/shell/cmd/label.cCommandRemCommandExitcmd_rmdircmd_mkdircmd_chdircmd_infocmd_if./base/shell/cmd/if.ccmd_goto./base/shell/cmd/goto.cCommandFree./base/shell/cmd/free.ccmd_forCommandEchocmd_dllDirReadParamCommandDirCommandDelay./base/shell/cmd/delay.cCommandDeletecmd_datecmd_copyCommandColorPrintCommandListDetailcmd_beep./base/shell/cmd/beep.cCommandAttribBreakHandler@4GetEnhancedVarSubstituteForVarsUnparseExecuteAsyncEchoCommandGetBatchVarSubstituteVarsDoDelayedExpansionPerformRedirectioncmd_cls./base/shell/cmd/cls.cCommandChoiceCommandChcp./base/shell/cmd/chcp.cCommandAssocCommandAlias./base/shell/cmd/alias.cExpandAliasReadCommandReadLineParseCharParseRemParseTokenParseRedirectionParseCommandPartParseCommandOpParseCommandBatchDoCommandCommandShowCommandsDetailExecuteCommandExecuteIfRunInstanceForDirForRecursiveExecuteForParseCommandLineExecuteAutoRunFilecmd_maincmd_call./base/shell/cmd/call.cParseForParseIfseta_assignmentseta_stmtseta_bitAndTermseta_unaryTermseta_mulTermcmd_set../../gcc/gcc/libgcc2.c__umoddi3__udivdi3C:/DOKUME~1/COLINF~1/LOKALE~1/Temp/cc6OOPOh.s../../gcc/gcc/config/i386/cygwin.asm__divdi3lib/3rdparty/mingw/crtexe.cpre_cpp_initpre_c_init__tmainCRTStartupinclude/psdk/winnt.hinclude/crt/mingw32/intrin_x86.hmainCRTStartupWinMainCRTStartup_gnu_exception_handler@4lib/3rdparty/mingw/dllargv.c_wsetargvlib/3rdparty/libwine/debug_ros.crelease_temp_bufferlib/3rdparty/libwine//debug.cwine_dbgstr_anwine_dbgstr_wnlibwine_freelibwine_malloclibwine__strduplibwine_realloc__wine_dbg_set_functionsdefault_dbg_vprintfdefault_dbgstr_wndefault_dbgstr_anget_temp_bufferwine_dbg_printfdefault_dbg_vlogwine_dbg_sprintfcmp_namedebug_init__wine_dbg_set_channel_flags__wine_dbg_get_channel_flagswine_dbg_loglib/3rdparty/mingw/_newmode.clib/3rdparty/mingw/wildcard.clib/3rdparty/mingw/tlssup.c__dyn_tls_init@12__dyn_tls_dtor@12__tlregdtorlib/3rdparty/mingw/charmax.cmy_lconv_initlib/3rdparty/mingw/mingw_helpers.c_decode_pointer_encode_pointerlib/3rdparty/mingw/merr.c_matherrlib/3rdparty/mingw/atonexit.cmingw_onexitatexitlib/3rdparty/mingw/xtxtmode.clib/3rdparty/mingw/natstart.clib/3rdparty/mingw/cinitexe.clib/3rdparty/mingw/gs_support.c__report_gsfailure__security_init_cookielib/3rdparty/mingw/pesect.c_ValidateImageBase_FindPESection_IsNonwritableInCurrentImagelib/3rdparty/mingw/pseudo-reloc.c__write_memory_pei386_runtime_relocatorlib/3rdparty/mingw/gccmain.c__do_global_ctors__main__do_global_dtorslib/3rdparty/mingw/CRT_fp10.c_fpresetlib/3rdparty/mingw/pseudo-reloc-list.cDllMainBreakHandler_gnu_exception_handler__dyn_tls_init__dyn_tls_dtorfpresetDeleteFileW_cexit_imp__GetConsoleAliasWVirtualProtect_imp__GetStartupInfoWGetStartupInfoW_obj_i386_dll_win32_kernel32_libkernel32_a_iname_imp__GlobalMemoryStatus__RUNTIME_PSEUDO_RELOC_LIST__SetLastErrorSetConsoleOutputCP_imp__GetConsoleModestrcspnsprintfSetEnvironmentVariableWQueryPerformanceCounterLocalReAlloc_imp__CloseHandleConvertSecurityDescriptorToStringSecurityDescriptorW_data_start__FreeLibrary__DTOR_LIST___imp___wcslwrSetConsoleTextAttribute__xi_a_imp__LocalFreefree_imp__VirtualProtectbCanExit__setusermatherrstrcmp_imp__GetKernelObjectSecurityGetConsoleAliasWUnhandledExceptionFilterGlobalMemoryStatus_imp__wcsrchr_itow_imp___onexit_imp__LocalReAllocwcsncmp_imp__GetLastErrorSetUnhandledExceptionFilter_imp__VirtualQueryFillConsoleOutputAttribute_imp___wchdir_imp__WriteConsoleW__tls_start____native_startup_lockSetHandleInformation_wtoi_imp___wtoi_imp___wcsnicmp_imp__GetConsoleAliasesLengthWReadConsoleInputW_imp__InterlockedExchangeGetVolumePathNameW_wfopenrand_imp__abort_imp__FillConsoleOutputAttributeGetEnvironmentVariableA__xl_cfctMsvcrtLongJmp_imp__wcspbrk_size_of_stack_commit___imp___fmode_imp__CreatePipe_size_of_stack_reserve___major_subsystem_version____crt_xl_start__bsearch_imp__CopyFileW_imp__FlushConsoleInputBuffer_imp__WideCharToMultiByteFlushConsoleInputBuffer_newmode_wpopen_imp__GetEnvironmentVariableA__crt_xi_start___imp__towlower_imp___amsg_exit__chkstkbIgnoreEcho_imp__LookupPrivilegeValueW__crt_xi_end__DbgPrint_imp__IsBadReadPtr_imp__vswprintf_imp___wcsicmp__xl_zVirtualAlloc_imp__rand_imp__AllocConsole_imp__RtlAssert_imp__GetConsoleScreenBufferInfoGetLastErrorGetEnvironmentStringsW_unlock_imp__QueryPerformanceCounterVirtualQuery_imp__FindNextFileWhOutmingw_initltsdrot_force_wcsuprDuplicateHandle_imp___wcmdln_imp__WaitForMultipleObjects_wcslwrSetConsoleCtrlHandler_imp___iob_dowildcard_imp__WriteFile_imp__GetVolumeInformationW_imp__AddConsoleAliasWFormatMessageWOpenProcessTokennDateFormatAdjustTokenPrivileges_imp__LocalAlloc_imp__SetConsoleCursorPosition_imp__GetFullPathNameW_imp__SetVolumeLabelWGetVersionExWcmdsGetConsoleMode_head_obj_i386_lib_debugsup_debugsup_ntdll_alpOriginalEnvironment_bss_start__MoveFileWtoupperGetFileAttributesW__RUNTIME_PSEUDO_RELOC_LIST_END___imp__VirtualFreeLoadLibraryW_size_of_heap_commit___imp__RegCloseKeyOutputCodePage__onexitendReadFile_imp__GetCurrentProcess_imp__MoveFileExW_wcsnsetSetConsoleModeGetCurrentDirectoryW_imp__SetEnvironmentVariableW_imp__GetProcessHeap_obj_i386_dll_win32_msvcrt_libmsvcrt_a_iname_stricmpFindFirstFileW_obj_i386_lib_debugsup_debugsup_ntdll_a_inamemingw_pcinitGetModuleFileNameWRegSetValueExW_imp__InterlockedExchangeAddFillConsoleOutputCharacterW_imp__GetProcAddressGetProcAddress_imp__CreateProcessW__crt_xp_start__cDecimalSeparatorcThousandSeparatorwcscmp_imp___itowSetFileAttributesWResumeThread_head_obj_i386_dll_win32_advapi32_libadvapi32_aMultiByteToWideChar_imp__RegQueryInfoKeyW_wcmdln_imp__swprintf_MINGW_INSTALL_DEBUG_MATHERR_imp__SetHandleInformation_imp__lstrlenW_imp__wcslenCreatePipe_imp___wpopen_imp__wcschr_imp__FormatMessageWwcsrchr_imp__isalnumbEcho__crt_xp_end__AddConsoleAliasWGetConsoleAliasesWnTimeFormat_imp__vDbgPrintExWithPrefixGetLocalTime_imp__signal_dll___imp__CreateFileW_imp__DeviceIoControl_minor_os_version__GetSystemTimewcstolCreateFileWSetConsoleCursorPosition_imp__GetConsoleAliasesWDeviceIoControlGetTickCount_image_base___imp__GetConsoleOutputCP_imp__exitInterlockedCompareExchange_section_alignment__GetModuleHandleWLoadLibraryAWriteConsoleW_imp__memmove_imp__SetFilePointercTimeSeparator__xc_awcsncpyRegDeleteKeyW_imp__SetFileAttributesW_imp__FreeLibrary_imp__fgetws_imp___wcsupr_imp__toupperCreateProcessWmemcpyCreateDirectoryWWaitForMultipleObjects_imp__GetSystemTime_imp____wgetmainargs_imp__SetConsoleTextAttributeGetFileTimetowlower_imp____lconv_init_imp__RegOpenKeyExW_RUNTIME_PSEUDO_RELOC_LIST__.weak.__MINGW_INSTALL_DEBUG_MATHERR._mainCRTStartupmemsetRegOpenKeyExW_imp__RegEnumKeyExWwcsncat_imp__memchr_tls_start_imp__SetConsoleCP_imp__ReadConsoleInputW_imp__wcscspn_imp__SetProcessAffinityMask_imp__wcscmpExitProcessRegQueryInfoKeyW_imp__OpenProcessToken_imp__wcscpyGetStdHandle__native_startup_state_imp__qsort_imp__GetDateFormatW_imp__GetFileAttributesWbDisableBatchEchoFileTimeToLocalFileTimewcscpy_imp___wfopen_data_end__FindClose_imp___wgetdcwd_imp__wcsncpy_imp__CopyFileExWtolower__xl_a__xl_d_CTOR_LIST____onexitbegin_imp__wcstok_imp__ResumeThread__set_app_type_imp__sprintf_charmax_imp__GetExitCodeProcess_bss_end___imp__RegQueryValueExW_imp__SetConsoleMode_imp__WaitForSingleObject__security_cookie_complement__crt_xc_end__fprintf_imp__RegSetValueExW_allocaIsBadReadPtr_tls_index_imp__HeapFreemaxx_imp__GetTickCountRegEnumKeyExW_imp__GetConsoleTitleWwcslen__crt_xc_start___imp__wcsstr_imp__SetLastError_head_obj_i386_dll_win32_msvcrt_libmsvcrt_alstrcmpiWGetConsoleCP_imp__SetConsoleTitleW_imp__strchr_imp__SetFileApisToOEM_wcsicmp_imp__SearchPathW__CTOR_LIST___imp__GetCurrentProcessId_imp__GetCommandLineW_head_obj_i386_dll_win32_kernel32_libkernel32_aGetKernelObjectSecuritymingw_app_type_imp__iswctypebDelayedExpansionAllocConsole_inittermSetVolumeLabelWLookupPrivilegeValueW_imp__GetVersionExW_imp___pclose_imp__TerminateProcess_fmodeCMD_ModuleHandle_imp__SetStdHandle_imp__GetFileTime_imp__DbgPrint_imp__SetLocalTimewcscat_imp__FileTimeToLocalFileTime_obj_i386_dll_win32_user32_libuser32_a_inameWaitForSingleObjectGetCurrentProcessId_imp____dllonexit_imp__wcscat_imp__memcpy_obj_i386_dll_win32_advapi32_libadvapi32_a_iname_imp___snwprintf_imp__GetModuleHandleW_imp__strcmp_file_alignment___imp__GetVolumePathNameW_imp__LoadLibraryW_imp___unlockmaxy_imp__wcstoulInterlockedExchangeAddisalphabChildProcessRunningrealloc_imp__mallocGetLocaleInfoWfcmemchr_imp__SetFileTime_imp__memcmp__mingw_pinitwcsstr_major_os_version__osviwcspbrk_imp__GetEnvironmentStringsW_imp__GetLocalTime_imp__ReadFileFileTimeToSystemTimeCloseHandlewcstokbCtrlBreak_lock_imp__realloc_imp__GetCurrentDirectoryW_imp__AdjustTokenPrivilegeswcstoul__xc_znNumberGroupsLocalFreeGetConsoleScreenBufferInfowcschr_tls_end_end___imp__GetStdHandleSetConsoleTitleWstrchrclrtableMessageBeep__dllonexit_imp__GetFileSizeExsignal_imp___lockmalloc_DTOR_LIST__GetFullPathNameWfclose_imp__fprintfTerminateProcessstrcpy_imp__lstrcmpiW_wgetdcwd_head_obj_i386_dll_win32_user32_libuser32_a_imp__memset_imp__fcloseRtlAssertbUnicodeOutputtextlineInputCodePagememcmp_imp___inittermSetStdHandleFindNextFileWnErrorLevelGetCurrentThreadId_pclose_size_of_heap_reserve___imp__RemoveDirectoryWLoadStringW__crt_xt_start__lstrlenWtowupper__ImageBaseSetFileApisToOEM_subsystem___imp__CreateDirectoryWBeep_imp__DuplicateHandle_imp__wcsncmpswprintf_imp__strcpyGetConsoleTitleWisalnumCopyFileWabort_imp__GetDiskFreeSpaceW_imp__MultiByteToWideChar__native_vcclrit_reason_wcsnicmp_imp__GetSystemTimeAsFileTimeSearchPathW_snwprintf__lconv_initSetConsoleCP_imp__MoveFileW_amsg_exitbc_imp__MessageBeep_imp__WriteConsoleInputWGetDiskFreeSpaceW__native_dllmain_reason_imp__towupper_onexit_imp__FileTimeToSystemTime__tls_end__HeapAlloc_imp__SetCurrentDirectoryWVirtualFreeGetExitCodeProcessGetVolumeInformationWwDefColorGetSystemTimeAsFileTime_imp__GetLocaleInfoWfgetws_imp__ExitProcessmingw_pcppinit__xi_zGetCurrentProcess__defaultmatherrSetConsoleCursorInfomingw_initltssuo_forcevswprintf_imp___wcsnset_imp__isalpha_imp__free_imp__GetModuleFileNameW_imp__SetUnhandledExceptionFilter_imp__FillConsoleOutputCharacterWInterlockedExchange_major_image_version__WriteFile_loader_flags___imp__UnhandledExceptionFilter_imp__tolowerRegCreateKeyExW_imp__FindFirstFileW_imp__DeleteFileW_imp__Beep_imp___stricmpcDateSeparatorvDbgPrintExWithPrefixdwChildProcessId_vsnprintfGenerateConsoleCtrlEvent_imp___cexit_imp__RegCreateKeyExWGetDateFormatW_imp__wcsspn_minor_subsystem_version___imp__FindClose_minor_image_version___imp__SleepHeapFreeGetConsoleOutputCPiswctype_imp____set_app_typewcscspn_imp__LoadStringW_imp__wcsncatmemmove_imp__InterlockedCompareExchangeGetFileSizeExmingw_initltsdyn_force_imp__HeapAlloc_imp__GetCurrentThreadIdexit__security_cookieWriteConsoleInputW_imp__SetConsoleCursorInfo__wgetmainargs_imp__ConvertSecurityDescriptorToStringSecurityDescriptorWGetProcessHeap_imp__LoadLibraryA_wchdir_imp__GenerateConsoleCtrlEventbExit_imp__SetConsoleOutputCP_imp__GetEnvironmentVariableW_imp____winitenv_imp__strcspnwcsspnGetCommandLineWSetLocalTimeRegCloseKeySetProcessAffinityMask_imp__FreeEnvironmentStringsW_RUNTIME_PSEUDO_RELOC_LIST_END__GetEnvironmentVariableWSetFileTime__dyn_tls_init_callbackhInqsortSleep_imp__bsearchmingw_initcharmax_imp____setusermatherr_imp__GetConsoleCPMoveFileExW_imp__wcstolGetConsoleAliasesLengthWLocalAllocFreeEnvironmentStringsW_tls_used_imp__RegDeleteKeyWRemoveDirectoryWWideCharToMultiByte__crt_xt_end___imp__SetConsoleCtrlHandler_imp__VirtualAllocRegQueryValueExWSetFilePointer_imp___vsnprintfCopyFileExW_imp__SystemTimeToFileTimeSetCurrentDirectoryWSystemTimeToFileTime